| Clone Name | rbaal27m13 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 104 bits (260), Expect = 5e-23 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 208 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 50 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY Sbjct: 365 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 89.7 bits (221), Expect = 2e-18 Identities = 40/53 (75%), Positives = 50/53 (94%) Frame = -3 Query: 208 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 50 +++GE++D+PLVKNLKR+PLIA L SE++A YLMPPIESGSVDFAEFEP+LVY Sbjct: 353 LAVGETSDIPLVKNLKRIPLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 88.2 bits (217), Expect = 5e-18 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = -3 Query: 205 SIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 50 ++GE+ D +VKNLKRVPLIA LVSEI+AAYLMPPIESGSVDFAEFEPKLVY Sbjct: 354 AVGETEDNSVVKNLKRVPLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 81.6 bits (200), Expect = 5e-16 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = -3 Query: 208 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 50 ++IGE++D +K LKR+PL+ L SEI+AAYLMPP+ESGSVDFAEFEP LVY Sbjct: 357 LAIGETDDASFIKTLKRIPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/53 (32%), Positives = 31/53 (58%) Frame = -3 Query: 208 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 50 ++IG N +K + + P++ ++V+E+ ++M P ESGS D + LVY Sbjct: 355 VNIGSMNLPSPIKAIMKAPILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407
>ACSF_PORPU (P51277) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -3 Query: 208 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 83 I I + PLVK + PL L+ +I YL+ PI+S +V Sbjct: 303 IDIDKKGSQPLVKTFMKAPLYMSLILNLIKIYLIKPIDSQAV 344
>ACSF1_ANASP (Q8YX57) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 351 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -3 Query: 202 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIES 92 I S+ VK ++++PLIA +V ++ YL+ PI++ Sbjct: 307 IERSSQPKFVKLIRKLPLIAAIVWNLLMVYLIKPIDT 343
>FUT8_DROME (Q9VYV5) Alpha-(1,6)-fucosyltransferase (EC 2.4.1.68) (Glycoprotein| 6-alpha-L-fucosyltransferase) (GDP-fucose--glycoprotein fucosyltransferase) (GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase) (alpha1-6FucT) Length = 619 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 Query: 100 IESGSVDFAEFEPKLVY*ICRKRIHT 23 +E+G D EFEP L Y R+RI T Sbjct: 140 LEAGVPDHGEFEPSLEYEFTRRRIQT 165
>KCNG1_HUMAN (Q9UIX4) Potassium voltage-gated channel subfamily G member 1| (Voltage-gated potassium channel subunit Kv6.1) (kH2) Length = 513 Score = 28.9 bits (63), Expect = 3.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 206 FYRRVQRLAPGEEPEEG 156 FYRR QRL P +EP +G Sbjct: 39 FYRRAQRLRPQDEPRQG 55
>DNAK_PSESM (Q87WP0) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 638 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 208 ISIGESNDLPLVKNLKRVPLIAQLVSE 128 I IG+ ND+ LV R+PL+ +LV+E Sbjct: 329 IDIGKINDVILVGGQTRMPLVQKLVTE 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,821,274 Number of Sequences: 219361 Number of extensions: 423247 Number of successful extensions: 1203 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1203 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)