| Clone Name | rbaal8a15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UVRC_STRCO (Q9Z512) UvrABC system protein C (Protein uvrC) (Exci... | 29 | 9.5 | 2 | CXCR2_RAT (P35407) High affinity interleukin-8 receptor B (IL-8R... | 29 | 9.5 |
|---|
>UVRC_STRCO (Q9Z512) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 728 Score = 28.9 bits (63), Expect = 9.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 70 VSSHQHYPTIEVRRGSETKNTTYFDGYQHS 159 V+ ++ +P ++V RG + K YF Y H+ Sbjct: 108 VTMNEEFPRVQVMRGQKKKGVRYFGPYGHA 137
>CXCR2_RAT (P35407) High affinity interleukin-8 receptor B (IL-8R B) (CXCR-2)| (GRO/MGSA receptor) (CD182 antigen) Length = 359 Score = 28.9 bits (63), Expect = 9.5 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Frame = -2 Query: 270 LYLIS*RSFCCLRCFVLVALIV---FFCFRLLVVADCLAQAMLVAIKICRIFGF*SSPDF 100 L ++ RS C + L+ L + FF L V A + +C++F F F Sbjct: 70 LVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWIFGSFLCKVFSFLQEITF 129 Query: 99 YSWVMLMA 76 YS V+L+A Sbjct: 130 YSSVLLLA 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,723,366 Number of Sequences: 219361 Number of extensions: 1397287 Number of successful extensions: 3094 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3091 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)