| Clone Name | rbaal27j06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD34_CANFA (Q28270) Hematopoietic progenitor cell antigen CD34 p... | 30 | 6.7 | 2 | PSTA_DICDI (P11976) Prestalk protein precursor | 29 | 8.7 |
|---|
>CD34_CANFA (Q28270) Hematopoietic progenitor cell antigen CD34 precursor| Length = 389 Score = 29.6 bits (65), Expect = 6.7 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +2 Query: 20 NSSVQIYKSLCISLSLTGSNAHKFAVTMEP 109 NSSVQ SL I++S T +N +VT+EP Sbjct: 107 NSSVQSQTSLAITVSFTPTNFSTSSVTLEP 136
>PSTA_DICDI (P11976) Prestalk protein precursor| Length = 1046 Score = 29.3 bits (64), Expect = 8.7 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -3 Query: 353 CSEAANSLP*ACSRQKGC*DTYCGNATGCEGVILTC 246 C + +P AC C C N+TGC L+C Sbjct: 87 CGKGCQHVPIACDDNNACTVDSCSNSTGCCHTPLSC 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,134,745 Number of Sequences: 219361 Number of extensions: 1468780 Number of successful extensions: 3857 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3856 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)