| Clone Name | rbaal27i15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, trac... | 29 | 6.4 | 2 | SYH_DEIRA (Q9RUN5) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histi... | 28 | 8.4 | 3 | AGRN_RAT (P25304) Agrin precursor | 28 | 8.4 |
|---|
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 28.9 bits (63), Expect = 6.4 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +3 Query: 303 TTGISRLLPSASGETSRTXAISASDCWKPPHTGSPMGRMSTPSTASWTSV 452 T +S PS++ ET+ T + + TGS STP TA T V Sbjct: 2531 TATMSTATPSSTPETAHTSTVLTATATTTGATGSVATPSSTPGTAHTTKV 2580
>SYH_DEIRA (Q9RUN5) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 427 Score = 28.5 bits (62), Expect = 8.4 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -3 Query: 421 DIRPIGDPVWGGFQQSEA---LIAXVREVSPEAEGSSLDIPVVNPPPANDHMQGGAT 260 D+ P G P FQ++ A LIA REV A +D P+ GG+T Sbjct: 11 DLLPSGSPKTEAFQRAAAHEWLIAQAREVLERAGAQRIDTPMFEEAELVKRGVGGST 67
>AGRN_RAT (P25304) Agrin precursor| Length = 1959 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 297 GFTTGISRLLPSASGET-SRTXAISASDCWKPPHTGSPMGRMSTPST 434 G TG + + +A T SR A S + P HT P+GR + P T Sbjct: 1152 GAATGTTAAMATARATTVSRLPASSVTPRVYPSHTSRPVGRTTAPPT 1198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,660,220 Number of Sequences: 219361 Number of extensions: 1080784 Number of successful extensions: 3081 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2966 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3075 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)