| Clone Name | rbaal27d21 |
|---|---|
| Clone Library Name | barley_pub |
>VSR3_ARATH (O80977) Vacuolar sorting receptor 3 precursor (AtVSR3) (Epidermal| growth factor receptor-like protein 2a) (AtELP2a) (BP80-like protein a') (AtBP80a') Length = 628 Score = 59.3 bits (142), Expect = 2e-09 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 287 YAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIHSH 183 Y VYKYR+R+YMDSEIRAIMAQYMPL++Q +I +H Sbjct: 588 YLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIPNH 622
>VSR4_ARATH (Q56ZQ3) Vacuolar sorting receptor 4 precursor (AtVSR4) (Epidermal| growth factor receptor-like protein 2b) (AtELP2b) (BP80-like protein a) (AtBP80a) Length = 628 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -1 Query: 287 YAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIHSH 183 Y VYKYR+R+YMDSEIRAIMAQYMPL++Q ++ +H Sbjct: 588 YLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVPNH 622
>VSR1_ARATH (P93026) Vacuolar sorting receptor 1 precursor (AtVSR1) (Epidermal| growth factor receptor-like protein 1) (AtELP1) (AtELP) (BP80-like protein b) (AtBP80b) (Spot 3 protein) Length = 623 Score = 58.2 bits (139), Expect = 5e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 293 AGYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 201 +GYAVYKYRIR YMD+EIR IMAQYMPLE+Q Sbjct: 582 SGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ 612
>VSR1_PEA (P93484) Vacuolar sorting receptor 1 precursor (BP-80) (80 kDa| proaleurein-binding protein) Length = 623 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 290 GYAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIHSH 183 G+ VYKYRIR+YMDSEIRAIMAQYMPL++Q + +H Sbjct: 582 GFLVYKYRIRQYMDSEIRAIMAQYMPLDSQEEGPNH 617
>VSR2_ARATH (O22925) Vacuolar sorting receptor 2 precursor (AtVSR2) (Epidermal| growth factor receptor-like protein 4) (AtELP4) (BP80-like protein c) (AtBP80c) Length = 625 Score = 55.5 bits (132), Expect = 3e-08 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 287 YAVYKYRIRRYMDSEIRAIMAQYMPLEN 204 Y VYKYRIR YMDSEIRAIMAQYMPL+N Sbjct: 586 YTVYKYRIRTYMDSEIRAIMAQYMPLDN 613
>VSR6_ARATH (Q9FYH7) Vacuolar sorting receptor 6 precursor (AtVSR6) (Epidermal| growth factor receptor-like protein 6) (AtELP6) (BP80-like protein d) (AtBP80d) Length = 622 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 290 GYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 201 GY YKYR+R YMDSEI AIM+QYMPLE+Q Sbjct: 572 GYVFYKYRLRSYMDSEIMAIMSQYMPLESQ 601
>VSR7_ARATH (Q8L7E3) Vacuolar sorting receptor 7 precursor (AtVSR7) (Epidermal| growth factor receptor-like protein 3) (AtELP3) (BP80-like protein f) (AtBP80f) Length = 625 Score = 51.6 bits (122), Expect = 5e-07 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 293 AGYAVYKYRIRRYMDSEIRAIMAQYMPLENQ 201 AGY YKYR R YMDSEI IM+QYMPLE+Q Sbjct: 581 AGYIFYKYRFRSYMDSEIMTIMSQYMPLESQ 611
>VSR5_ARATH (O64758) Vacuolar sorting receptor 5 precursor (AtVSR5) (Epidermal| growth factor receptor-like protein 5) (AtELP5) (BP80-like protein e) (AtBP80e) Length = 618 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/29 (58%), Positives = 24/29 (82%) Frame = -1 Query: 287 YAVYKYRIRRYMDSEIRAIMAQYMPLENQ 201 Y YKY ++ YMDSEI +IM+QY+PL++Q Sbjct: 582 YIFYKYHLQSYMDSEIVSIMSQYIPLDSQ 610
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 191 HSHPHQIEM*RAXPHSPVYGTNIFRS 114 H HPHQI PHS +G + RS Sbjct: 229 HPHPHQIPHPHPQPHSQPHGHRLLRS 254
>GLI3_XENLA (Q91660) Zinc finger protein GLI3 (Neural-specific DNA-binding| protein xGLI3) (xGLI-3) Length = 1569 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = -3 Query: 273 VSDPEVHGFRDPRHHGAVHA----PGEPGRHSQSSSP 175 V PE H + R G +H P EPG HSQS SP Sbjct: 636 VHGPEAHVTKKQR--GDIHPRPPPPREPGSHSQSRSP 670
>MRAW_THETN (Q8R9F9) S-adenosyl-methyltransferase mraW (EC 2.1.1.-)| Length = 308 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 128 SFHKLENAAXLFTSQSGEDDCECLPGSPGAC 220 +FH LE+ T + E+ C C PG P C Sbjct: 240 TFHSLEDRIVKNTFKKLENPCTCPPGLPCTC 270
>CWF19_SCHPO (Q09909) Cell cycle control protein cwf19| Length = 639 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 270 SDPEVHGFRDPRHHGAVHAPGEPGRHSQSSSP 175 +D E + R RHH + H + GRH +S P Sbjct: 18 TDRETNHSRRHRHHHSRHRESKHGRHDRSERP 49
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch| 4) [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/55 (30%), Positives = 21/55 (38%) Frame = +2 Query: 101 QSHMPNEKCSFHKLENAAXLFTSQSGEDDCECLPGSPGACTAP*WRGSLNPCTSG 265 Q+H+ E C N + SG C C PG G S NPC +G Sbjct: 112 QTHL-EELCPPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANG 165
>HIF1A_ONCMY (Q98SW2) Hypoxia-inducible factor 1 alpha (HIF-1 alpha) (HIF1| alpha) Length = 766 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 63 TERS*YAVQ*DRYNHTCRTKNVRSINWRMRRCSSHLNL 176 TERS + + RT NV+S W++ CS H+ + Sbjct: 165 TERSFFLRMKCTLTNRGRTVNVKSATWKVLHCSDHVRV 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,180,428 Number of Sequences: 219361 Number of extensions: 858382 Number of successful extensions: 2632 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2632 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)