ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal26l12 |
|---|---|
| Clone Library Name | barley_pub |
>PMP3_MOUSE (P05143) Proline-rich protein MP-3 (Fragment)| Length = 296 Score = 33.9 bits (76), Expect = 0.25 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 321 RSVPSAPQGADPIHGSRTGHPPTSGDHTHSAEAPPCSGQP 440 R PS Q P++GS+ G PP G + PP G P Sbjct: 12 RPPPSGSQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPGGP 51 Score = 30.4 bits (67), Expect = 2.7 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +3 Query: 330 PSAPQGADPIHGSRT----GHPPTSGDHTHSAEAPPCSGQP 440 P PQG P G + G PP +G H + PP +G P Sbjct: 137 PRPPQGPPPPAGPQPRPPQGPPPPAGPHLRPTQGPPPTGGP 177
>PRP2_MOUSE (P05142) Proline-rich protein MP-2 precursor| Length = 261 Score = 32.7 bits (73), Expect = 0.55 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +3 Query: 321 RSVPSAPQGADPIHGSRTGHPPTSGDHTHSAEAPPCSGQP 440 R PS Q P++GS+ G PP G + PP G P Sbjct: 33 RPPPSGFQPRPPVNGSQQGPPPPGGPQPRPPQGPPPPGGP 72
>SYRM_RHIET (Q08812) HTH-type transcriptional regulator syrM (Symbiotic| regulator) Length = 336 Score = 31.6 bits (70), Expect = 1.2 Identities = 22/90 (24%), Positives = 37/90 (41%), Gaps = 8/90 (8%) Frame = +3 Query: 42 AVSTGEPDYYGPAYCLLPLLRLQCTAL--CGITSVRLVIPALHYIXXXXXXXXXXXXXXA 215 A+ST PD++GP Y LP LR + + + + +V A + Sbjct: 231 AISTDSPDHFGPIYDHLPNLRADRSPILFSSVLTAAVVASATDLVLLVPRRVATQVSAML 290 Query: 216 P---ADERRRPSP---LLLYGQKIHHHTLH 287 P D P+P +L++ ++ HH H Sbjct: 291 PLRVVDPPLEPAPYKVMLIWHERCHHDPQH 320
>PRB2_HUMAN (P02812) Basic salivary proline-rich protein 2 (Salivary| proline-rich protein) (Con1 glycoprotein) [Contains: Basic peptide P-F] (Fragment) Length = 382 Score = 30.8 bits (68), Expect = 2.1 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 321 RSVPSAPQGADPIHGSR-TGHPPTSGDHTHSAEAPPCSGQP 440 RS P PQG G+ G PP +G + +APP +GQP Sbjct: 326 RSPPGKPQGPPQQEGNNPQGPPPPAGGNPQQPQAPP-AGQP 365
>BIB_DROME (P23645) Neurogenic protein big brain| Length = 696 Score = 30.8 bits (68), Expect = 2.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 339 PQGADPIHGSRTGHPPTSGDHTHSAEAP 422 PQG P++G+RT P G+H + P Sbjct: 531 PQGFQPVYGTRTNPTPMDGNHKYDRRDP 558
>DSX_DROME (P23023) Protein doublesex| Length = 549 Score = 29.6 bits (65), Expect = 4.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 330 PSAPQGADPIHGSRTGHPPTSGDHTHSAEAP 422 PS+P G +H + P +S HSA +P Sbjct: 463 PSSPSGPSAVHNQKPSRPGSSNGTVHSAASP 493
>PRP1_HUMAN (P04280) Basic salivary proline-rich protein 1 precursor (Salivary| proline-rich protein) [Contains: Basic peptide IB-6; Peptide P-H] Length = 392 Score = 29.6 bits (65), Expect = 4.7 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +3 Query: 321 RSVPSAPQGADPIHGSR-TGHPPTSGDHTHSAEAPPCSGQP 440 R+ P PQG G+ G PP +G + +APP +GQP Sbjct: 336 RAPPGKPQGPPQQEGNNPQGPPPPAGGNPQQPQAPP-AGQP 375
>ZC3H3_HUMAN (Q8IXZ2) Zinc finger CCCH-type domain-containing protein 3| Length = 948 Score = 29.3 bits (64), Expect = 6.1 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +3 Query: 324 SVPSAPQGADPIHGSRTGHPPTSGDHTHSAEAPPCSGQ 437 S P A P+HG+R G PP H + GQ Sbjct: 84 SDPPADHAVRPLHGARGGRPPVPQQHVLERQVQLSQGQ 121
>TLDD_HAEIN (P45297) Protein tldD homolog| Length = 482 Score = 28.9 bits (63), Expect = 7.9 Identities = 21/64 (32%), Positives = 30/64 (46%) Frame = -3 Query: 342 VELKELI*RSGRARTMKFHEVCGDGSSVHREGAVMASCARLLERRRLCSNLDIDKVVVYN 163 +EL L+ R+ RA + +V SSV+ E +MA+ L R L I +V N Sbjct: 136 IELLHLVDRTARAEDHRVTKVSASLSSVYEEVLIMATDGTLAADIRPLVRLSISVLVEEN 195 Query: 162 VMRE 151 RE Sbjct: 196 GKRE 199
>TRPA_METTH (O27697) Tryptophan synthase alpha chain (EC 4.2.1.20)| Length = 270 Score = 28.9 bits (63), Expect = 7.9 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 8/88 (9%) Frame = -3 Query: 291 FHEVCGDGSSVH-------REGAVMASCARLLERRRLCSNLDIDKVVVYN-VMRE*PDEL 136 F + DG+SV R G C +L+ER R +++ I +V YN + R DE Sbjct: 56 FSDPIADGTSVQGADLRALRAGMTTEKCFQLIERVREFTSIPIGLLVYYNLIYRMGVDEF 115 Query: 135 K*CRIMQCTAAAVVVADSKQDHNSLALR 52 R + ++ AD + S ALR Sbjct: 116 Y-RRAAEAGVTGILAADLPPEEASDALR 142
>ATI_CAMPS (Q775Q2) A-type inclusion protein (ATI)| Length = 726 Score = 28.9 bits (63), Expect = 7.9 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Frame = -3 Query: 477 NLLRELVDMGFRQVDLNKEVLRQNEYDLQKSVDDLCGFHEWDPLLV-ELKELI*RSGRAR 301 +L R+ V+ R L KE+ D+Q DD E D ++ EL+E + R R Sbjct: 451 SLERDSVNKTERIDRLTKEIKELR--DIQNGTDDGSDSSEIDKKIIRELRESLDREREMR 508 Query: 300 TMKFHEVCGDGSSVHREGAVMASCARLLERRRL 202 + E+ R+G V SC R LE RR+ Sbjct: 509 SKLEKEL-----DTIRDGKVDGSCQRELELRRM 536
>ATI_CAMPM (Q8V2M9) A-type inclusion protein (ATI)| Length = 726 Score = 28.9 bits (63), Expect = 7.9 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Frame = -3 Query: 477 NLLRELVDMGFRQVDLNKEVLRQNEYDLQKSVDDLCGFHEWDPLLV-ELKELI*RSGRAR 301 +L R+ V+ R L KE+ D+Q DD E D ++ EL+E + R R Sbjct: 451 SLERDSVNKTERIDRLTKEIKELR--DIQNGTDDGSDSSEIDKKIIRELRESLDREREMR 508 Query: 300 TMKFHEVCGDGSSVHREGAVMASCARLLERRRL 202 + E+ R+G V SC R LE RR+ Sbjct: 509 SKLEKEL-----DTIRDGKVDGSCQRELELRRM 536 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,802,609 Number of Sequences: 219361 Number of extensions: 1375892 Number of successful extensions: 4097 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4074 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
