| Clone Name | rbaal26k11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAF6_HUMAN (P49848) Transcription initiation factor TFIID subuni... | 33 | 0.55 | 2 | IL6RB_RAT (P40190) Interleukin-6 receptor beta chain precursor (... | 32 | 2.1 | 3 | MNT_MOUSE (O08789) Max-binding protein MNT (Protein ROX) (Myc an... | 30 | 4.6 | 4 | MSH5_RAT (Q6MG62) MutS protein homolog 5 | 30 | 6.0 |
|---|
>TAF6_HUMAN (P49848) Transcription initiation factor TFIID subunit 6| (Transcription initiation factor TFIID 70 kDa subunit) (TAF(II)70) (TAFII-70) (TAFII-80) (TAFII80) Length = 677 Score = 33.5 bits (75), Expect = 0.55 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +3 Query: 495 PHPRPATPRLMCVPSPVEVEA---MSCGAALPPVHYPGKGQWAALSSCASAP 641 P P P TP L+ VP + + +S AA PP P ++ +SS +SAP Sbjct: 497 PQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAP 548
>IL6RB_RAT (P40190) Interleukin-6 receptor beta chain precursor (IL-6R-beta)| (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (CD130 antigen) Length = 918 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +2 Query: 278 DTIILVH-----QESPETSMEFTMYAKRGATTSVHRAMSPFMCGFILTTLMSGLWCGRSR 442 DT+ +VH +E + EFT + A + + P F+LTTL+ L+C R Sbjct: 584 DTLYMVHMAAYTEEGGKDGPEFTFTTLKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKR 643
>MNT_MOUSE (O08789) Max-binding protein MNT (Protein ROX) (Myc antagonist MNT)| Length = 591 Score = 30.4 bits (67), Expect = 4.6 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 471 QPPACRTE---PHPRPATPRLMCVPSPVEVEAMSCGAALPPVH 590 QPP +T P P PATP VP+PV + A + G + H Sbjct: 404 QPPQQKTPLPGPPPPPATPTQTLVPAPVHLVATAGGGSTVIAH 446
>MSH5_RAT (Q6MG62) MutS protein homolog 5| Length = 831 Score = 30.0 bits (66), Expect = 6.0 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = -2 Query: 435 RPHHSPLISVVKMKPHMKGLIALCTLVVAPLFAYMVNSMDVSGLSWCTRIMVSCGVSGAL 256 RPH+SP I V++K L+ LC P NS D G +++ SG Sbjct: 543 RPHYSPCIQGVRIKNGRHPLMELCARTFVP------NSTDCGGDQGRVKVITGPNSSGKS 596 Query: 255 TY 250 Y Sbjct: 597 IY 598 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,684,627 Number of Sequences: 219361 Number of extensions: 2099497 Number of successful extensions: 5921 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5907 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)