| Clone Name | rbaal26j03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CO8A_RABIT (P98136) Complement component C8 alpha chain precurso... | 34 | 0.19 | 2 | VIRB4_AGRTU (P0A3W0) Protein virB4 precursor | 30 | 3.5 | 3 | VIRB4_AGRT9 (P0A3W1) Protein virB4 precursor | 30 | 3.5 |
|---|
>CO8A_RABIT (P98136) Complement component C8 alpha chain precursor (Complement| component 8 alpha subunit) Length = 585 Score = 34.3 bits (77), Expect = 0.19 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 9/64 (14%) Frame = -3 Query: 229 CMHARTIESNMCI*CTYVIY*HR-VYMVRSFGG--------DTANCFVPFACIKPAATGQ 77 C + E C C Y HR + FGG D A+C+ P AC++PA GQ Sbjct: 39 CQLSSWSEWTDCFPCQDTKYRHRSLLQPNKFGGTICSGDIWDRASCYSPTACLRPAQCGQ 98 Query: 76 CIMC 65 C Sbjct: 99 DFQC 102
>VIRB4_AGRTU (P0A3W0) Protein virB4 precursor| Length = 789 Score = 30.0 bits (66), Expect = 3.5 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 18 IRTFNQLVMCLSTEHRHIIHCPVAAGLMHANGTKQFAVSPPKDRTIY 158 +R N +++ + + H++ P+ A L+ TK F SP DR+ Y Sbjct: 656 VRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAY 702
>VIRB4_AGRT9 (P0A3W1) Protein virB4 precursor| Length = 789 Score = 30.0 bits (66), Expect = 3.5 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 18 IRTFNQLVMCLSTEHRHIIHCPVAAGLMHANGTKQFAVSPPKDRTIY 158 +R N +++ + + H++ P+ A L+ TK F SP DR+ Y Sbjct: 656 VRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAY 702 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,502,857 Number of Sequences: 219361 Number of extensions: 1035029 Number of successful extensions: 2073 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2070 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)