ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal25p05 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 50.4 bits (119), Expect(2) = 1e-10 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 182 ISIGESNDLPLVKNLKRVPLIAQLV 108 ISIGESNDLPLVKNLKRVPLIAQLV Sbjct: 365 ISIGESNDLPLVKNLKRVPLIAQLV 389 Score = 33.1 bits (74), Expect(2) = 1e-10 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 103 EIIAAYLMPPIESGS 59 EIIAAYLMPPIESGS Sbjct: 391 EIIAAYLMPPIESGS 405 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 78 PQSSLAPVDFAEFEPKLVY 22 P VDFAEFEPKLVY Sbjct: 399 PPIESGSVDFAEFEPKLVY 417
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 32.3 bits (72), Expect(3) = 6e-07 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 124 LLPN*CXEIIAAYLMPPIESGS 59 L+ + EI+AAYLMPP+ESGS Sbjct: 376 LVTSLASEILAAYLMPPVESGS 397 Score = 30.4 bits (67), Expect(3) = 6e-07 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 182 ISIGESNDLPLVKNLKRVPLIAQL 111 ++IGE++D +K LKR+PL+ L Sbjct: 357 LAIGETDDASFIKTLKRIPLVTSL 380 Score = 27.3 bits (59), Expect(3) = 6e-07 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 78 PQSSLAPVDFAEFEPKLVY 22 P VDFAEFEP LVY Sbjct: 391 PPVESGSVDFAEFEPNLVY 409
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 16/24 (66%), Positives = 23/24 (95%) Frame = -3 Query: 182 ISIGESNDLPLVKNLKRVPLIAQL 111 +++GE++D+PLVKNLKR+PLIA L Sbjct: 353 LAVGETSDIPLVKNLKRIPLIAAL 376 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -1 Query: 103 EIIAAYLMPPIESGS 59 E++A YLMPPIESGS Sbjct: 379 ELLATYLMPPIESGS 393 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 78 PQSSLAPVDFAEFEPKLVY 22 P VDFAEFEP+LVY Sbjct: 387 PPIESGSVDFAEFEPQLVY 405
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = -3 Query: 179 SIGESNDLPLVKNLKRVPLIAQLV 108 ++GE+ D +VKNLKRVPLIA LV Sbjct: 354 AVGETEDNSVVKNLKRVPLIAALV 377 Score = 32.3 bits (72), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 Query: 103 EIIAAYLMPPIESGS 59 EI+AAYLMPPIESGS Sbjct: 379 EILAAYLMPPIESGS 393 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 78 PQSSLAPVDFAEFEPKLVY 22 P VDFAEFEPKLVY Sbjct: 387 PPIESGSVDFAEFEPKLVY 405
>EFGL_SYNY3 (Q55421) Elongation factor G-like protein| Length = 669 Score = 31.2 bits (69), Expect = 0.79 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 3 SFFDKFSRQAWAQIRQNQ-REPDSIGGMRYAAMISXH*LGNKRNPLQVLHQGQVVGLS 173 ++F R + A+I Q RE DS+ G R + GN++ P+Q G++VGL+ Sbjct: 302 TYFTPQGRLSLARIWQGTLREADSLNGQRLGGIYRL--FGNQQTPVQTATVGEIVGLA 357
>MEGF6_RAT (O88281) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1574 Score = 28.9 bits (63), Expect = 3.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 144 EPEEGSSYCPTSVLRSSLRTSCPQSSLAP 58 +P G+ YCP L + +CPQ P Sbjct: 1275 DPATGACYCPAGFLGADCSLACPQGRFGP 1303
>MEGF6_MOUSE (Q80V70) Multiple epidermal growth factor-like domains 6 (EGF-like| domain-containing protein 3) (Multiple EGF-like domain protein 3) (Fragment) Length = 656 Score = 28.9 bits (63), Expect = 3.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 144 EPEEGSSYCPTSVLRSSLRTSCPQSSLAP 58 +P G+ YCP L + +CPQ P Sbjct: 357 DPATGACYCPAGFLGADCSLACPQGRFGP 385
>KCNG1_HUMAN (Q9UIX4) Potassium voltage-gated channel subfamily G member 1| (Voltage-gated potassium channel subunit Kv6.1) (kH2) Length = 513 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 180 FYRRVQRLAPGEEPEEG 130 FYRR QRL P +EP +G Sbjct: 39 FYRRAQRLRPQDEPRQG 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,844,705 Number of Sequences: 219361 Number of extensions: 325833 Number of successful extensions: 921 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 901 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
