ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal25n24 |
|---|---|
| Clone Library Name | barley_pub |
>CB24_ARATH (P27521) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCI type III CAB-4) (LHCP) Length = 251 Score = 60.5 bits (145), Expect = 1e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADPWXXPIIQTIS 149 GF+VQHNVTGKGPFENL QHL+DPW I+QT + Sbjct: 218 GFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN 251
>CB26_ARATH (Q9XF89) Chlorophyll a-b binding protein CP26, chloroplast| precursor (Light-harvesting complex II protein 5) (LHCB5) (LHCIIc) Length = 280 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADPWXXPIIQTISG 146 GF +Q VTG+GP ENL +HL+DP+ ++ I+G Sbjct: 238 GFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAG 272
>CB2_PHYPA (P20866) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 269 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 229 GFFVQAIVTGKGPLENLNDHLADP 252
>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,| chloroplast precursor (DE Chlorophyll a-b binding protein type I F3) (CAB-F3) (LHCP) Length = 265 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPIENLSDHLADP 249
>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor| (LHCII type I CAB-E) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 227 GFFVQALVTGKGPLENLADHLADP 250
>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor| (LHCII type I CAB-25) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 227 GFFVQAIVTGKGPLENLADHLADP 250
>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor| (LHCII type I CAB-16) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 227 GFFVQAIVTGKGPLENLADHLADP 250
>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 227 GFFVQAIVTGKGPLENLADHLADP 250
>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast| precursor (CAB) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 227 GFFVQAIVTGKGPIENLYDHLADP 250
>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type I CAB-13) (LHCP) Length = 266 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 227 GFFVQAIVTGKGPLENLADHLADP 250
>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,| chloroplast precursor (Chlorophyll a-b binding protein type II 1B) (CAB) (LHCP) Length = 274 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 235 GFFVQAIVTGKGPIENLADHLADP 258
>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast| precursor (LHCII type I CAB-AB80) (LHCP) Length = 269 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 230 GFFVQAIVTGKGPLENLADHLADP 253
>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 206 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 167 GFFVQAIVTGKGPLENLADHLADP 190
>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type II CAB-1A) (LHCP) Length = 278 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 239 GFFVQAIVTGKGPIENLADHLADP 262
>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,| chloroplast precursor (Chlorophyll a-b binding protein type II 1A) (CAB) (LHCP) Length = 278 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 239 GFFVQAIVTGKGPIENLADHLADP 262
>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 261 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 222 GFFVQAIVTGKGPLENLADHLADP 245
>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) (Fragment) Length = 255 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 216 GFFVQAIVTGKGPLENLADHLADP 239
>CB22_PINSY (P15192) Chlorophyll a-b binding protein type 2 member 2| (Chlorophyll a-b binding protein type II 2) (CAB) (LHCP) (Fragment) Length = 150 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 111 GFFVQAIVTGKGPIENLYDHLADP 134
>CB22_SOYBN (P09755) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 256 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 217 GFFVQAIVTGKGPLENLADHLADP 240
>CB2D_LYCES (P10707) Chlorophyll a-b binding protein 1D (LHCII type I CAB-1D)| (LHCP) (Fragment) Length = 116 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 77 GFFVQAIVTGKGPLENLADHLADP 100
>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor| (LHCII type I CAB-1C) (LHCP) (Fragments) Length = 265 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPLENLADHLADP 249
>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor| (LHCII type I CAB-1B) (LHCP) Length = 265 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPLENLADHLADP 249
>CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloroplast precursor| (LHCII type I CAB-1A) (LHCP) (Fragments) Length = 265 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPLENLADHLADP 249
>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor| (LHCII type I CAB-M9) (LHCP) Length = 265 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPLENLADHLADP 249
>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor| (LHCII type I CAB-21) (LHCP) Length = 265 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPLENLADHLADP 249
>CB21_RAPSA (P14584) Chlorophyll a-b binding of LHCII type 1 protein| (Chlorophyll a-b binding of LHCII type I protein) (CAB) (LHCP) (Fragment) Length = 124 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 85 GFFVQAIVTGKGPLENLADHLADP 108
>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 265 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPLENLADHLADP 249
>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor| (Allergen Api g 3) Length = 264 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 225 GFFVQAIVTGKGPLENLADHLADP 248
>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (LHCP) Length = 264 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 225 GFFVQAIVTGKGPLENLADHLADP 248
>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor| (LHCII type I CAB-3C) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor| (LHCII type I CAB-50) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor| (LHCII type I CAB-91R) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor| (LHCII type I CAB-40) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor| (LHCII type I CAB-22R) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor| (LHCII type I CAB-C) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPLENLADHLADP 251
>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor| (LHCII type I CAB-2) (CAB-140) (LHCP) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPIENLADHLADP 251
>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast| precursor (LHCII type I CAB-165/180) Length = 267 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 228 GFFVQAIVTGKGPIENLADHLADP 251
>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor| (LHCII type I CAB-5) (LHCP) (Fragment) Length = 237 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 198 GFFVQAIVTGKGPIENLSDHIADP 221
>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 265 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 226 GFFVQAIVTGKGPLENLADHIADP 249
>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor| (LHCII type II CAB-151) (LHCP) Length = 265 Score = 39.3 bits (90), Expect = 0.003 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLADP Sbjct: 226 GFFVQAIVTGKGPIENLFDHLADP 249
>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 264 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 225 GFFVQAIVTGKGPIENLADHIADP 248
>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor| (LHCII type I CAB-1) (LHCP) Length = 262 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 223 GFFVQAIVTGKGPLENLADHIADP 246
>CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloroplast precursor| (LHCII type I CAB-3B) (LHCP) (Fragments) Length = 267 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 228 GFFVQAIVTGKGPLENLADHIADP 251
>CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloroplast precursor| (LHCII type I CAB-3A) (LHCP) (Fragments) Length = 267 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 228 GFFVQAIVTGKGPLENLADHIADP 251
>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCII type I CAB-8) Length = 268 Score = 38.9 bits (89), Expect = 0.004 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HL+DP Sbjct: 229 GFFVQAIVTGKGPLENLADHLSDP 252
>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor| (LHCII type I CAB-37) (LHCP) Length = 265 Score = 38.9 bits (89), Expect = 0.004 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 226 GFFVQAIVTGKGPIENLYDHVADP 249
>CB2_CHLMO (P22686) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 256 Score = 38.9 bits (89), Expect = 0.004 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP +NL HLADP Sbjct: 217 GFFVQAIVTGKGPIQNLADHLADP 240
>CB2_DUNTE (P27517) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 38.5 bits (88), Expect = 0.005 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP +NL HLADP Sbjct: 214 GFFVQAIVTGKGPVQNLTDHLADP 237
>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) (Fragment) Length = 245 Score = 38.5 bits (88), Expect = 0.005 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLA+P Sbjct: 206 GFFVQAIVTGKGPLENLADHLAEP 229
>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor| (LHCII type I CAB-48) (LHCP) Length = 264 Score = 38.5 bits (88), Expect = 0.005 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HL DP Sbjct: 225 GFFVQAIVTGKGPIENLADHLTDP 248
>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCII type I CAB-7) (LHCP) Length = 267 Score = 38.5 bits (88), Expect = 0.005 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP +NL HLADP Sbjct: 228 GFFVQAIVTGKGPLDNLVDHLADP 251
>CB22_PETSP (P04780) Chlorophyll a-b binding protein 22L, chloroplast precursor| (LHCII type I CAB-22L) (LHCP) Length = 267 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF +Q VTGKGP ENL HL DP Sbjct: 228 GFFIQAIVTGKGPLENLADHLVDP 251
>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 263 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 224 GFFVQAIVTGKGPIENLFDHVADP 247
>CB2_DUNSA (P20865) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 273 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLA+P Sbjct: 235 GFFVQAIVTGKGPIENLTDHLANP 258
>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor| (LHCII type I CAB-36) (LHCP) Length = 265 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ADP Sbjct: 226 GFFVQAIVTGKGPIENLFDHVADP 249
>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor| (LHCII type II CAB-215) (LHCP) Length = 265 Score = 37.7 bits (86), Expect = 0.008 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP +NL H+ADP Sbjct: 226 GFFVQAIVTGKGPIQNLYDHVADP 249
>CB4A_ARATH (Q07473) Chlorophyll a-b binding protein CP29.1, chloroplast| precursor (LHCII protein 4.1) (LHCB4.1) Length = 290 Score = 37.7 bits (86), Expect = 0.008 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADPWXXPIIQTIS 149 GF VQ TGKGP N HL+DP II T S Sbjct: 255 GFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFS 288
>CB4B_ARATH (Q9XF88) Chlorophyll a-b binding protein CP29.2, chloroplast| precursor (LHCII protein 4.2) (LHCB4.2) Length = 287 Score = 37.7 bits (86), Expect = 0.008 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADPWXXPIIQTIS 149 GF VQ TGKGP N HL+DP II T S Sbjct: 252 GFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFS 285
>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I| CAB-AB96) (LHCP) (Major 15) (Fragment) Length = 228 Score = 37.7 bits (86), Expect = 0.008 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF V VTGKGP ENL HLADP Sbjct: 189 GFFVPAIVTGKGPLENLADHLADP 212
>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor| (LHCII type I CAB) (LHCP) Length = 266 Score = 37.4 bits (85), Expect = 0.010 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP E+L H+ADP Sbjct: 227 GFFVQAIVTGKGPLEDLADHIADP 250
>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor| (LHCII type I CAB-4) (LHCP) Length = 265 Score = 37.4 bits (85), Expect = 0.010 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL H+ DP Sbjct: 226 GFFVQAIVTGKGPIENLSDHINDP 249
>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor| (LHCII type I CAB-3) (LHCP) Length = 263 Score = 37.4 bits (85), Expect = 0.010 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HLA P Sbjct: 224 GFFVQAIVTGKGPLENLADHLAGP 247
>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,| chloroplast precursor (CAB) Length = 268 Score = 37.0 bits (84), Expect = 0.013 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HL DP Sbjct: 229 GFFVQAIVTGKGPLENLFDHLDDP 252
>CB2_CHLRE (P14273) Chlorophyll a-b binding protein of LHCII type I,| chloroplast precursor (CAB) (LHCP) Length = 253 Score = 37.0 bits (84), Expect = 0.013 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP +NL HLA+P Sbjct: 214 GFFVQAIVTGKGPVQNLDDHLANP 237
>CB13_LYCES (P27522) Chlorophyll a-b binding protein 8, chloroplast precursor| (LHCI type III CAB-8) Length = 273 Score = 35.4 bits (80), Expect = 0.039 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 G+ +Q VTG GP++NL HLADP Sbjct: 238 GYFIQALVTGVGPYQNLLDHLADP 261
>CB23_LYCES (P27489) Chlorophyll a-b binding protein 13, chloroplast precursor| (LHCII type III CAB-13) Length = 265 Score = 35.4 bits (80), Expect = 0.039 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF VQ VTGKGP ENL HL +P Sbjct: 226 GFFVQAIVTGKGPLENLLDHLDNP 249
>CB11_LYCES (P12360) Chlorophyll a-b binding protein 6A, chloroplast precursor| (LHCI type I CAB-6A) (Light-harvesting complex I 26 kDa protein) Length = 246 Score = 35.0 bits (79), Expect = 0.051 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -2 Query: 250 GFLVQHNV-TGKGPFENLQQHLADPW 176 GF VQ + G GP ENL HLADPW Sbjct: 205 GFCVQQSAYLGTGPLENLATHLADPW 230
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 32.7 bits (73), Expect = 0.25 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADPWXXPIIQTIS 149 G QH TG GP +NL HLADP I S Sbjct: 235 GAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 32.7 bits (73), Expect = 0.25 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADPWXXPIIQTIS 149 G QH TG GP +NL HLADP I S Sbjct: 235 GAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268
>CB21_EUGGR (P12327) Chlorophyll a-b binding protein of LHCII type 1| (Chlorophyll a-b binding protein of LHCII type I) (CAB) (LHCP) (Fragment) Length = 127 Score = 31.2 bits (69), Expect = 0.74 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 GF Q VTG+GP EN HL DP Sbjct: 83 GFYAQAIVTGEGPVENWLYHLQDP 106
>CO8A_RABIT (P98136) Complement component C8 alpha chain precursor (Complement| component 8 alpha subunit) Length = 585 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 252 WGSWCSTT*PGRGRSRTCSSTWPTHGXXP 166 WGSW T R R R C++ P +G P Sbjct: 546 WGSWSPCTAGTRERRRECNNPAPQNGGAP 574
>CO8B_HUMAN (P07358) Complement component C8 beta chain precursor (Complement| component 8 beta subunit) Length = 591 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 252 WGSWCSTT*PGRGRSRTCSSTWPTHGXXPSSRPSPANKSVD 130 W +W S + + R R C++ P +G P S PA++++D Sbjct: 551 WSNWSSCSGRRKTRQRQCNNPPPQNGGSPCS--GPASETLD 589
>OPSD1_ANGAN (Q90214) Rhodopsin, deep-sea form| Length = 352 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 247 FLVQHNVTG--KGPFENLQQHLADPWXXPII 161 ++ N+TG + PFE Q +LA+PW I+ Sbjct: 10 YIPMSNITGVVRSPFEYPQYYLAEPWAYTIL 40
>LH15_EUGGR (P08975) Light-harvesting complex I LH35 proteins precursor| [Contains: LH35 protein 1; LH35 protein 2] (Fragment) Length = 331 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 G VQ++VT +GP NL +HL P Sbjct: 110 GLEVQNHVTAQGPVANLIEHLRHP 133
>OPSD_MOUSE (P15409) Rhodopsin| Length = 348 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -2 Query: 232 NVTGKG--PFENLQQHLADPW 176 NVTG G PFE Q +LA+PW Sbjct: 15 NVTGVGRSPFEQPQYYLAEPW 35
>LH18_EUGGR (P08976) Light-harvesting complex I LH38 proteins precursor| [Contains: LH38 protein 1; LH38 protein 2; LH38 protein 3] (Fragment) Length = 530 Score = 27.7 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 250 GFLVQHNVTGKGPFENLQQHLADP 179 G Q+ TG+ P NL HLA+P Sbjct: 327 GLTAQYLATGESPLANLSAHLANP 350
>P73_HUMAN (O15350) Tumor protein p73 (p53-like transcription factor)| (p53-related protein) Length = 636 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -1 Query: 161 PDHLRP--INPSISPTNEVSGGLN 96 P HL+P P +SP N+V GG+N Sbjct: 399 PSHLQPPSYGPVLSPMNKVHGGMN 422 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,005,991 Number of Sequences: 219361 Number of extensions: 667041 Number of successful extensions: 2068 Number of sequences better than 10.0: 78 Number of HSP's better than 10.0 without gapping: 2006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2067 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
