| Clone Name | rbaal26b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3 | 32 | 1.3 | 2 | LKH1_SCHPO (Q10156) Dual specificity protein kinase lkh1 (EC 2.7... | 30 | 6.6 | 3 | SURE_HAHCH (Q2SKW4) 5'-nucleotidase surE (EC 3.1.3.5) (Nucleosid... | 30 | 8.7 |
|---|
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 32.3 bits (72), Expect = 1.3 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -2 Query: 309 AILATDCVCVCVCLFAKKKDCCCVIHVFLFHVCV 208 +IL++ CVCVCVC+ C CV+ +VCV Sbjct: 367 SILSSVCVCVCVCVCMYV--CMCVMESACVYVCV 398
>LKH1_SCHPO (Q10156) Dual specificity protein kinase lkh1 (EC 2.7.12.1)| Length = 575 Score = 30.0 bits (66), Expect = 6.6 Identities = 20/66 (30%), Positives = 28/66 (42%) Frame = -1 Query: 604 LNPPRMVDRTTHLRPSLLPAEQHGYAPVHSTNVVPVRFCGVFSVARLPHLLNQMHPHRLI 425 L PP + +H P LP+ + P+ V+P LP L Q+HP+RL Sbjct: 38 LRPPPVPQVPSHWYPVSLPSPNLPHQPISKPPVIP----------NLPKL--QVHPNRLP 85 Query: 424 RPAGEH 407 P H Sbjct: 86 HPIHNH 91
>SURE_HAHCH (Q2SKW4) 5'-nucleotidase surE (EC 3.1.3.5) (Nucleoside| 5'-monophosphate phosphohydrolase) Length = 249 Score = 29.6 bits (65), Expect = 8.7 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 505 VPVRFCGVFSVARLPHLLNQMHPHRLIRPAGEHYFWIA 392 VP+ + RL H L PH ++ P G +WIA Sbjct: 164 VPLEDIRGIQLTRLGHRLKGGEPHEIVDPRGRKRYWIA 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,841,903 Number of Sequences: 219361 Number of extensions: 2205321 Number of successful extensions: 5162 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5130 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)