| Clone Name | rbaal25j23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BBS2_RAT (Q99MH9) Bardet-Biedl syndrome 2 protein homolog | 30 | 1.8 | 2 | MYO7A_MOUSE (P97479) Myosin-7A (Myosin VIIa) | 29 | 3.9 | 3 | ADA10_XENLA (Q8JIY1) ADAM 10 precursor (EC 3.4.24.81) (A disinte... | 29 | 3.9 |
|---|
>BBS2_RAT (Q99MH9) Bardet-Biedl syndrome 2 protein homolog| Length = 721 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 57 ERLARGRMHVVHPGTAHIVSSVDTYVHMSVDMPMHVH 167 E + G HVVHP T ++ SS+ + D+P+ +H Sbjct: 420 EGIFAGESHVVHPSTHNLSSSIRVPITPPKDVPVDLH 456
>MYO7A_MOUSE (P97479) Myosin-7A (Myosin VIIa)| Length = 2215 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 60 RLARGRMHVVHPGTAHIVSSVDTYVHMSVDMPMHVHAYVRE 182 RL R R H+++ T I+ +V+ Y +S+ P H+ Y + Sbjct: 85 RLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNK 125
>ADA10_XENLA (Q8JIY1) ADAM 10 precursor (EC 3.4.24.81) (A disintegrin and| metalloproteinase domain 10) (Kuzbanian protein homolog) (xKuz) Length = 749 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 29 TGSVILRRRGATSEGTHACCSSGDSPHRFFSRYVRTHERGYADACPRVRA 178 +G VILR++ A + C + H F+ RY T E A V+A Sbjct: 204 SGPVILRKKRAAQAEKNTCQLFIQTDHLFYKRYGETREAVIAQISSHVKA 253 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,839,352 Number of Sequences: 219361 Number of extensions: 1034341 Number of successful extensions: 2525 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2522 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)