ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal25i15 |
|---|---|
| Clone Library Name | barley_pub |
>SFR11_HUMAN (Q05519) Splicing factor arginine/serine-rich 11 (Arginine-rich 54| kDa nuclear protein) (p54) Length = 484 Score = 34.3 bits (77), Expect = 0.30 Identities = 17/43 (39%), Positives = 29/43 (67%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQ 490 ++K++D E + DE E+ +K+K+ D +K ERK E DKD++ Sbjct: 378 KKKDKDKERSRDERERSTSKKKKSKDK-EKDRERKSESDKDVK 419
>SYM_BACHD (Q9KGK8) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 660 Score = 33.5 bits (75), Expect = 0.52 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 3/52 (5%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDA--LKKSEE-RKVEIDKDLQAMQLLS 472 +EKEE +E+T+D+F KV + +DA +KK++ K+++D + Q++S Sbjct: 548 DEKEESDEITIDDFSKVELRIAEVIDAEPVKKADRLLKIQLDLGYEKRQVVS 599
>YO77_SCHPO (Q9USW9) Hypothetical protein C1921.07c in chromosome II| Length = 244 Score = 33.5 bits (75), Expect = 0.52 Identities = 19/60 (31%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = -3 Query: 612 KEEDNEMTLDEFEKVMEEKRKALDA-LKKSEERKVEIDKDLQAMQLLST--KKGNDEVFI 442 K+E+ T+D + +EE+ KA DA ++ SEE+K E++ +Q+++++ +K N++ I Sbjct: 31 KQEECYKTVDGDDNPIEERIKACDAGIQTSEEQKKELEHTMQSLEMIINVLEKANEKPVI 90
>PCSK6_RAT (Q63415) Proprotein convertase subtilisin/kexin type 6 precursor| (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin/kexin-like protease PACE4) (Subtilisin-like proprotein convertase 4) (SPC4) Length = 937 Score = 32.7 bits (73), Expect = 0.88 Identities = 19/48 (39%), Positives = 22/48 (45%) Frame = -2 Query: 316 PRPWRQGPRGSWRLQRRIRWRGLSQPAACSGNPGPEPVPNPRWEVRLL 173 PRPWR W L L+ PA CS P P PV W V++L Sbjct: 28 PRPWR------WLLL-------LALPAVCSALPPPRPVYTNHWAVQVL 62
>Y157_AQUAE (O66547) Hypothetical protein aq_157 precursor| Length = 162 Score = 32.3 bits (72), Expect = 1.2 Identities = 14/30 (46%), Positives = 24/30 (80%) Frame = -3 Query: 588 LDEFEKVMEEKRKALDALKKSEERKVEIDK 499 L++++K+++EK+K L+ALKKS E K +K Sbjct: 50 LEKYQKLIQEKQKKLEALKKSLESKALSEK 79
>MYH10_RAT (Q9JLT0) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 32.3 bits (72), Expect = 1.2 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = -3 Query: 618 EEKEEDNEMTLD---EFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDE 451 E+ EE + L E E +E++RK AL + ++K+EID KDL+A Q+ + K DE Sbjct: 1585 EQNEEKKRLLLKQVRELEAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDE 1642 Query: 450 VFIKL 436 V +L Sbjct: 1643 VIKQL 1647
>MYH10_MOUSE (Q61879) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 32.3 bits (72), Expect = 1.2 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = -3 Query: 618 EEKEEDNEMTLD---EFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDE 451 E+ EE + L E E +E++RK AL + ++K+EID KDL+A Q+ + K DE Sbjct: 1585 EQNEEKKRLLLKQVRELEAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDE 1642 Query: 450 VFIKL 436 V +L Sbjct: 1643 VIKQL 1647
>SWC3_CANGA (Q6FRS1) SWR1-complex protein 3| Length = 659 Score = 32.3 bits (72), Expect = 1.2 Identities = 13/44 (29%), Positives = 29/44 (65%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQA 487 +EKEE ++ ++ +K EEK++ L K+ E+++++ K+ +A Sbjct: 208 KEKEEQKKLESEQRKKRAEEKKQMLQLKKQEREKQMQLQKEARA 251
>NOC3L_MOUSE (Q8VI84) Nucleolar complex protein 3 homolog (NOC3 protein homolog)| (NOC3-like protein) (Nucleolar complex-associated protein 3-like protein) (Factor for adipocyte differentiation 24) Length = 807 Score = 32.0 bits (71), Expect = 1.5 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = -3 Query: 615 EKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEI-DKDLQAMQLLSTKKGNDEVFIK 439 ++EE+ E L++ E+V+E+ RK L + ERK ++ DK +Q L S + E IK Sbjct: 174 QQEEEAEEELEDEEEVIEDPRKELTIEEHVIERKKKLQDKKIQIAALASAILSDPESHIK 233
>FKBP3_KLULA (Q6CWE8) FK506-binding protein 3 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) Length = 418 Score = 32.0 bits (71), Expect = 1.5 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = -3 Query: 615 EKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQ 490 E+EE+ E +E +K++EE +K A K E+KVE KDL+ Sbjct: 252 EEEEEEEEEEEEEQKLVEETKKNKKAKK---EKKVEFKKDLE 290
>MYH10_HUMAN (P35580) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 31.6 bits (70), Expect = 2.0 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = -3 Query: 618 EEKEEDNEMTLD---EFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDE 451 E+ EE + + E E +E++RK AL + ++K+EID KDL+A Q+ + K DE Sbjct: 1585 EQNEEKKRLLIKQVRELEAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDE 1642 Query: 450 VFIKL 436 V +L Sbjct: 1643 VIKQL 1647
>MYH10_BOVIN (Q27991) Myosin-10 (Myosin heavy chain, nonmuscle IIb) (Nonmuscle| myosin heavy chain IIb) (NMMHC II-b) (NMMHC-IIB) (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) Length = 1976 Score = 31.6 bits (70), Expect = 2.0 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = -3 Query: 618 EEKEEDNEMTLD---EFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDE 451 E+ EE + + E E +E++RK AL + ++K+EID KDL+A Q+ + K DE Sbjct: 1585 EQNEEKKRLLIKQVRELEAELEDERKQR-ALAVASKKKMEIDLKDLEA-QIEAANKARDE 1642 Query: 450 VFIKL 436 V +L Sbjct: 1643 VIKQL 1647
>MYH11_RAT (Q63862) Myosin-11 (Myosin heavy chain, smooth muscle isoform)| (SMMHC) (Fragments) Length = 1327 Score = 31.2 bits (69), Expect = 2.6 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFI 442 EEK + L E+E +E++RK AL + ++K+E D KDL+ +Q S KG +E Sbjct: 943 EEKRRQLQRQLHEYETELEDERKQ-RALAAAAKKKLEGDLKDLE-LQADSAVKGREEAIK 1000 Query: 441 KL 436 +L Sbjct: 1001 QL 1002
>PCSK6_HUMAN (P29122) Proprotein convertase subtilisin/kexin type 6 precursor| (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin/kexin-like protease PACE4) (Subtilisin-like proprotein convertase 4) (SPC4) Length = 969 Score = 30.8 bits (68), Expect = 3.4 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = -2 Query: 316 PRPWRQGPRGSWRLQRRIRWRGLSQPAACSGNPGPEPVPNPRWEVRLL 173 PRPWR W L L+ PAACS P P PV W V++L Sbjct: 46 PRPWR------WLLL-------LALPAACSAPP-PRPVYTNHWAVQVL 79
>MYH11_RABIT (P35748) Myosin-11 (Myosin heavy chain, smooth muscle isoform)| (SMMHC) Length = 1972 Score = 30.8 bits (68), Expect = 3.4 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFI 442 EEK + L E+E +E++RK AL + ++K+E D KDL+ +Q S KG +E Sbjct: 1588 EEKRRQLQRQLHEYETELEDERKQ-RALAAAAKKKLEGDLKDLE-LQADSAIKGREEAIK 1645 Query: 441 KL 436 +L Sbjct: 1646 QL 1647
>MYH11_MOUSE (O08638) Myosin-11 (Myosin heavy chain, smooth muscle isoform)| (SMMHC) Length = 1972 Score = 30.8 bits (68), Expect = 3.4 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFI 442 EEK + L E+E +E++RK AL + ++K+E D KDL+ +Q S KG +E Sbjct: 1588 EEKRRQLQRQLHEYETELEDERKQ-RALAAAAKKKLEGDLKDLE-LQADSAIKGREEAIK 1645 Query: 441 KL 436 +L Sbjct: 1646 QL 1647
>MYH11_HUMAN (P35749) Myosin-11 (Myosin heavy chain, smooth muscle isoform)| (SMMHC) Length = 1972 Score = 30.8 bits (68), Expect = 3.4 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEID-KDLQAMQLLSTKKGNDEVFI 442 EEK + L E+E +E++RK AL + ++K+E D KDL+ +Q S KG +E Sbjct: 1588 EEKRRQLQRQLHEYETELEDERKQ-RALAAAAKKKLEGDLKDLE-LQADSAIKGREEAIK 1645 Query: 441 KL 436 +L Sbjct: 1646 QL 1647
>UACA_HUMAN (Q9BZF9) Uveal autoantigen with coiled-coil domains and ankyrin| repeats protein Length = 1416 Score = 30.8 bits (68), Expect = 3.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -3 Query: 615 EKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKV 511 EKEE+++ ++E K+ E + ALKK E R+V Sbjct: 1189 EKEEESQNKMEEVSKLQSEVQNTKQALKKLETREV 1223
>ADPP_BACSU (P54570) ADP-ribose pyrophosphatase (EC 3.6.1.13) (ADP-ribose| diphosphatase) (Adenosine diphosphoribose pyrophosphatase) (ADPR-PPase) (ADP-ribose phosphohydrolase) (ASPPase) Length = 185 Score = 30.8 bits (68), Expect = 3.4 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = -3 Query: 609 EEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKK 463 EE E+ DEF +VME + DALK E R+V K A+Q L K+ Sbjct: 133 EEKRELDEDEFVEVMEVTLE--DALKLVESREVYDAKTAYAIQYLQLKE 179
>TCL2_CAEEL (Q9N428) T-cell defective protein 2| Length = 435 Score = 30.8 bits (68), Expect = 3.4 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -1 Query: 530 SLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVLI 426 +LK + K +RI++L + P+KE+ +S W++I Sbjct: 341 ALKEAKEKEMRIWKLAPFETPKKEVPLYSGRWLVI 375
>NOP8_YEAST (Q08287) 60S ribosome subunit biogenesis protein NOP8| Length = 484 Score = 30.8 bits (68), Expect = 3.4 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQ 490 EE+EE+ E+ E+E V + K ++ +K EERK + + D Q Sbjct: 283 EEEEEEKEVNAPEYENVNKTKDQSTLPQEKPEERKEQDEGDGQ 325
>CALD1_CHICK (P12957) Caldesmon (CDM)| Length = 771 Score = 30.4 bits (67), Expect = 4.4 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 5/51 (9%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKAL---DALKKSE--ERKVEIDKDLQAMQ 481 +EK+++ + LDE +K EE+RK L + KK E ERK+ +++ + M+ Sbjct: 514 KEKQQEAAVELDELKKRREERRKILEEEEQKKKQEEAERKIREEEEKKRMK 564 Score = 30.4 bits (67), Expect = 4.4 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 615 EKEEDNEMTLDEFEKVMEEKRKALDALKKSEER-KVEIDKDLQAMQLLSTKKGNDE 451 E EE + +E +K EEK+KA + K +EER + + +++ +A + K +E Sbjct: 256 EAEEKERLKAEEEKKAAEEKQKAEEEKKAAEERERAKAEEEKRAAEERERAKAEEE 311
>CALD1_MELGA (P13505) Caldesmon, smooth muscle (CDM) (Fragment)| Length = 274 Score = 30.4 bits (67), Expect = 4.4 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 5/51 (9%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKAL---DALKKSE--ERKVEIDKDLQAMQ 481 +EK+++ + LDE +K EE+RK L + KK E ERK+ +++ + M+ Sbjct: 17 KEKQQEAAVELDELKKRREERRKILEEEEQKKKQEEAERKIREEEEKKRMK 67
>MYO3_CAEEL (P12844) Myosin-3 (Myosin heavy chain A) (MHC A)| Length = 1969 Score = 29.6 bits (65), Expect = 7.5 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQA 487 +EKEE+ E T ++ +E + L+A K +E + I K L++ Sbjct: 1590 QEKEEEFENTRRNHQRALESMQATLEAETKQKEEALRIKKKLES 1633
>KCY_PYRHO (O58988) Cytidylate kinase (EC 2.7.4.14) (CK) (Cytidine| monophosphate kinase) (CMP kinase) Length = 192 Score = 29.6 bits (65), Expect = 7.5 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -3 Query: 579 FEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGN 457 F ++ +EK +L+ +K E EID+++ Q+ + K+GN Sbjct: 40 FRQMAKEKGMSLEEFQKYAELHPEIDREVDRRQIEAAKEGN 80
>MAP1A_HUMAN (P78559) Microtubule-associated protein 1A (MAP 1A)| (Proliferation-related protein p80) [Contains: MAP1 light chain LC2] Length = 2805 Score = 29.6 bits (65), Expect = 7.5 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 606 EDNEMTLDEFEKVMEEKRKALDALKKSEERKVEID 502 E + L++ EK+ EEK KALD +S E K D Sbjct: 1479 EQKDRVLEQKEKIPEEKDKALDQKVRSVEHKAPED 1513
>DEK_MOUSE (Q7TNV0) Protein DEK| Length = 380 Score = 29.6 bits (65), Expect = 7.5 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVE 508 EE+EED+E +E E+ EEK K+L K E++KVE Sbjct: 34 EEEEEDDEDDDEEDEE--EEKEKSLIVEGKREKKKVE 68
>GDF6_BOVIN (P55106) Growth/differentiation factor 6 precursor (GDF-6)| (Cartilage-derived morphogenetic protein 2) (CDMP-2) (Fragment) Length = 436 Score = 29.6 bits (65), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 241 PAACSGNPGPEPVPNPRWEV 182 PAA S PGP P P WEV Sbjct: 168 PAAGSAEPGPAGAPRPGWEV 187
>TIF1G_HUMAN (Q9UPN9) Transcription intermediary factor 1-gamma (TIF1-gamma)| (RET-fused gene 7 protein) (Rfg7 protein) (Tripartite motif protein 33) Length = 1127 Score = 29.6 bits (65), Expect = 7.5 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEI 505 E++E+D E+T D E ++ +RK L KS+ER V I Sbjct: 1093 EQEEDDGEVTEDSDEDFIQPRRKRL----KSDERPVHI 1126
>RF1_CLOPE (Q8XIB9) Peptide chain release factor 1 (RF-1)| Length = 360 Score = 29.6 bits (65), Expect = 7.5 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGNDEVFIK 439 EE E + EM +E ++ M E + +K ERK E++ ++Q + L + VF++ Sbjct: 57 EELEANKEMLSEESDQEMREMINS--EIKDLTERKKELEDEIQILLLPKDPNDDKNVFVE 114 Query: 438 L 436 + Sbjct: 115 I 115
>FLHC_SALTY (O52222) Flagellar transcriptional activator flhC| Length = 192 Score = 29.3 bits (64), Expect = 9.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 542 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 429 ML + R +LIR+++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIRLYKELRGSPPPKGMLPFSTDWFM 65
>PPN1_NEUCR (Q9P3S1) Endopolyphosphatase (EC 3.6.1.10)| Length = 734 Score = 29.3 bits (64), Expect = 9.8 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKK 463 EE+EE+ E +E E+ EE+ + D L EE V+ D D ++ + KK Sbjct: 645 EEEEEEEEDLFEEVEETDEEEEQEDDDLSDGEE--VDDDSDEDELETETFKK 694
>UACA_BOVIN (Q8HYY4) Uveal autoantigen with coiled-coil domains and ankyrin| repeats protein (Beta-actin-binding protein) (BetaCAP73) Length = 1401 Score = 29.3 bits (64), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -3 Query: 615 EKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKV 511 EKEE+++ +E K+ E + ALKK E R+V Sbjct: 1174 EKEEESQNKTEEVSKLQSEIQNTKQALKKLETREV 1208
>LA_AEDAL (Q26457) La protein homolog (La ribonucleoprotein) (La autoantigen| homolog) Length = 383 Score = 29.3 bits (64), Expect = 9.8 Identities = 10/38 (26%), Positives = 25/38 (65%) Frame = -3 Query: 594 MTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQ 481 +T + + E+K+ +DA++KS+E +E+ +D + ++ Sbjct: 83 LTFKRLKSLSEDKKVIVDAIEKSDEGLIEVSEDREKLR 120
>RPGR1_MOUSE (Q9EPQ2) X-linked retinitis pigmentosa GTPase regulator-interacting| protein 1 (RPGR-interacting protein 1) Length = 1331 Score = 29.3 bits (64), Expect = 9.8 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -3 Query: 618 EEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKD 496 EEKEE+ E +E E+ EEK + + +K EE + E +++ Sbjct: 941 EEKEEEEEEEREEEEEKEEEKEEEEEEDEKEEEEEEEEEEE 981
>FLHC_XENNE (Q9X9F3) Flagellar transcriptional activator flhC| Length = 194 Score = 29.3 bits (64), Expect = 9.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 542 ML*RSLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVL 429 ML + R +LIR+++ PP K M+ FS++W + Sbjct: 28 MLESETQLSRGRLIRLYKELRGSPPPKGMLPFSTDWFM 65 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,655,784 Number of Sequences: 219361 Number of extensions: 1425283 Number of successful extensions: 5833 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 5189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5797 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
