| Clone Name | rbaal25i09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CHD9_MOUSE (Q8BYH8) Chromodomain-helicase-DNA-binding protein 9 ... | 30 | 4.2 | 2 | PE2R_RABIT (P80508) Prostaglandin-E(2) 9-reductase (EC 1.1.1.189... | 30 | 4.2 | 3 | NVL_HUMAN (O15381) Nuclear valosin-containing protein-like (Nucl... | 29 | 5.5 | 4 | POLS_EEVVM (P36331) Structural polyprotein (p130) [Contains: Cap... | 28 | 9.4 |
|---|
>CHD9_MOUSE (Q8BYH8) Chromodomain-helicase-DNA-binding protein 9 (EC 3.6.1.-)| (ATP-dependent helicase CHD9) (CHD-9) (Peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein) (PPAR-alpha-interacting complex protein 320 kDa) Length = 2885 Score = 29.6 bits (65), Expect = 4.2 Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +2 Query: 32 SCSLTTHRSNSQLELQHHHKVLGHVSTGNLI*ILSNLC--HTSALSIANTQLSNLAGSLH 205 SCS+ SNSQ H+ GHVS +L+ + L HT N LS+ AGS Sbjct: 259 SCSV----SNSQQFPSHYSFSSGHVSPSSLLQSSAGLAPGHT------NQALSDFAGSNS 308 Query: 206 RNPHR 220 +PHR Sbjct: 309 FSPHR 313
>PE2R_RABIT (P80508) Prostaglandin-E(2) 9-reductase (EC 1.1.1.189)| (20-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.149) (20-alpha-HSD) Length = 323 Score = 29.6 bits (65), Expect = 4.2 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 307 LGSHREVEWRHRHPPVLLE 363 LGSHRE EW + PVLLE Sbjct: 219 LGSHREPEWVDQSAPVLLE 237
>NVL_HUMAN (O15381) Nuclear valosin-containing protein-like (Nuclear VCP-like| protein) (NVLp) Length = 856 Score = 29.3 bits (64), Expect = 5.5 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = +2 Query: 95 LGHVSTGNLI*ILSNLCHTSALSIANTQLSNLAGSLHRNPHRQESPLPQCKTNGESGSEP 274 L H++ G + L LC +A+ N L L +NP ++ P + G+EP Sbjct: 462 LAHLTPGFVGADLMALCREAAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEE-RLGTEP 520 Query: 275 LMEAKDDM 298 E +D++ Sbjct: 521 TSETQDEL 528
>POLS_EEVVM (P36331) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1254 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 146 HTSALSIANTQLSNLAGSLHRNPHRQESPLPQCKTNGESGSEPLMEAK 289 H + +T LS S+H P +S L +C+ G SE + AK Sbjct: 501 HLPGSEVDSTLLSTSGSSVHVTPPAGQSVLVECECGGTKISETINSAK 548 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,226,408 Number of Sequences: 219361 Number of extensions: 1239965 Number of successful extensions: 3650 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3648 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)