| Clone Name | rbaal25i03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PAPOG_HUMAN (Q9BWT3) Poly(A) polymerase gamma (EC 2.7.7.19) (PAP... | 28 | 4.5 | 2 | PRP2_YEAST (P20095) Pre-mRNA-splicing factor ATP-dependent RNA h... | 28 | 5.9 |
|---|
>PAPOG_HUMAN (Q9BWT3) Poly(A) polymerase gamma (EC 2.7.7.19) (PAP gamma)| (Polynucleotide adenylyltransferase gamma) (SRP RNA 3' adenylating enzyme) Length = 736 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 194 TQRKKRMPGSFLPRSSKYIXTNNI 265 T RKKR+P LP SS + NNI Sbjct: 700 TSRKKRLPSKELPDSSSPVPANNI 723
>PRP2_YEAST (P20095) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP2| (EC 3.6.1.-) Length = 876 Score = 28.1 bits (61), Expect = 5.9 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 128 QTMNRGRGGLSVQWHP-DVAFPRTQRKKRMPGSFLPRSSKYIXTNNI*LLNTQKTKTVLV 304 QTM R GGL+V HP + F + K + P SKY+ + L + + + LV Sbjct: 796 QTMGRSSGGLNVSVHPTSILFVNHKEKAQRP-------SKYVLYQQLMLTSKEFIRDCLV 848 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,696,708 Number of Sequences: 219361 Number of extensions: 736802 Number of successful extensions: 1581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1581 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)