| Clone Name | rbaal25h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | X_HBVIA (P24026) Trans-activating protein X | 32 | 2.2 | 2 | FXR1_MOUSE (Q61584) Fragile X mental retardation syndrome-relate... | 30 | 8.5 |
|---|
>X_HBVIA (P24026) Trans-activating protein X| Length = 154 Score = 31.6 bits (70), Expect = 2.2 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 10/75 (13%) Frame = +2 Query: 308 LNTLPDPLPEYMLSLSPSPLFLKALPFCQ---------KY*TQRVVQITIH-HSFLHKIF 457 L TL P P + + + L L+ LP C ++ + R ++ T++ H FL K+ Sbjct: 34 LGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVL 93 Query: 458 FRKSQNLSRASTTQL 502 +++ LS STT L Sbjct: 94 HKRTLGLSVMSTTDL 108
>FXR1_MOUSE (Q61584) Fragile X mental retardation syndrome-related protein 1| Length = 677 Score = 29.6 bits (65), Expect = 8.5 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 380 RPSKIRERERERAYIQGEDR-GGCLGTADYQGRSRGTAG 267 RPS R ERE+ Y E G+ Y GR RG G Sbjct: 383 RPSSTRGPEREKGYATDESTVSSVQGSRSYSGRGRGRRG 421 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,900,673 Number of Sequences: 219361 Number of extensions: 1719058 Number of successful extensions: 3840 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3835 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)