| Clone Name | rbaal25f23 |
|---|---|
| Clone Library Name | barley_pub |
>ACON_SCHPO (O13966) Aconitate hydratase, mitochondrial precursor (EC 4.2.1.3)| (Citrate hydro-lyase) (Aconitase) Length = 778 Score = 30.0 bits (66), Expect = 1.6 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -3 Query: 224 PVNSDIYKR-TYIKISSDRCECNAMGVRTRYCPVLDAGWPDVNLP 93 PVN DI + +Y+K+ DR C + + AG P+V +P Sbjct: 73 PVNQDIERGVSYLKLRPDRVACQDATAQMAILQFMSAGMPEVAVP 117
>PYRC_METKA (Q8TXX9) Dihydroorotase (EC 3.5.2.3) (DHOase)| Length = 426 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 172 DVNAMPWECVPVIAQYWMPDGPM*ICHKQ 86 D A+PW +P I + PDGP+ I H + Sbjct: 154 DAPAVPWSTLPEIFRELSPDGPLTIFHPE 182
>I18BP_MOUSE (Q9Z0M9) Interleukin-18-binding protein precursor (IL-18BP)| (Interferon gamma-inducing factor-binding protein) Length = 191 Score = 29.6 bits (65), Expect = 2.1 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 182 SSDRCECNAMGVRTRYCPVLDAGWPDVNLP*AIEPFFLHHFLTRNCTA 39 S D C + V T+ P LD WP+ +P L+ LT +CTA Sbjct: 41 SKDPCSSWSPAVPTKQYPALDVIWPEKEVP-------LNGTLTLSCTA 81
>SCAM4_HUMAN (Q969E2) Secretory carrier-associated membrane protein 4 (Secretory| carrier membrane protein 4) Length = 229 Score = 28.5 bits (62), Expect = 4.7 Identities = 21/77 (27%), Positives = 30/77 (38%), Gaps = 1/77 (1%) Frame = +3 Query: 27 YASHSSTIPRQKMVKKKRFYCLWQIHIGPSGIQYWAITGTHSHGIAFTSIG-RYLDICTF 203 Y + S IP + V KR Y LW + G+ A G + T+ G ++ + F Sbjct: 22 YQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLAWWIGGGSGTNFGLAFVWLLLF 81 Query: 204 VYVGVNRWGRXTAPMFR 254 G W R FR Sbjct: 82 TPCGYVCWFRPVYKAFR 98
>ADRO_HUMAN (P22570) NADPH:adrenodoxin oxidoreductase, mitochondrial precursor| (EC 1.18.1.2) (Adrenodoxin reductase) (AR) (Ferredoxin reductase) (Ferredoxin--NADP(+) reductase) Length = 491 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 119 AGWPDVNLP*A-IEPFFLHHFLTRNCTAM*CII 24 + WP LP A P F HHF T+ T C++ Sbjct: 12 SAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVV 44
>Y1728_HAEIN (O05087) Hypothetical protein HI1728| Length = 397 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 117 GIQYWAITGTHSHGIAFTSIGRYLDICTFVYVGVNRW 227 G+ WA + T G A+TS+ +C + NRW Sbjct: 274 GVVIWAASVTSVIGAAYTSVSFLTTLCPTIERNRNRW 310 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,957,354 Number of Sequences: 219361 Number of extensions: 791704 Number of successful extensions: 2259 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2259 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)