| Clone Name | rbaal24p18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-as... | 30 | 7.5 | 2 | PHS_RHOS4 (Q3IZF4) Putative pterin-4-alpha-carbinolamine dehydra... | 30 | 9.8 |
|---|
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.0 bits (66), Expect = 7.5 Identities = 16/60 (26%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Frame = -3 Query: 189 VEICCKPL*CFPSVKQ----------CNPLQLCLKFLNVCFCV*LCIGFVSCADHCNVDA 40 V +CCKP+ C P+ + C P CV +C V C C+ D+ Sbjct: 90 VPVCCKPVCCLPTCSKDSSSCCQQSSCQPTCCASSSCQQSCCVPVCCKPVCCVPTCSEDS 149
>PHS_RHOS4 (Q3IZF4) Putative pterin-4-alpha-carbinolamine dehydratase (EC| 4.2.1.96) (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) Length = 92 Score = 29.6 bits (65), Expect = 9.8 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -2 Query: 565 PMLLAQWQQGVTRSDLAKEFSFEEFIKRAG---NFAMLAERFLH 443 P+L A W R L+K F FE F+ G A+ AE++ H Sbjct: 9 PLLAAGWSHDPERGVLSKTFGFETFVAAFGFMTRVALWAEKWNH 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,505,278 Number of Sequences: 219361 Number of extensions: 2100495 Number of successful extensions: 5000 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4851 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4991 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7422931207 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)