ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal24m17 |
|---|---|
| Clone Library Name | barley_pub |
>TRXF1_ARATH (Q9XFH8) Thioredoxin F-type 1, chloroplast precursor (TRX-F1)| Length = 178 Score = 80.1 bits (196), Expect = 1e-15 Identities = 39/51 (76%), Positives = 41/51 (80%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 DCN DNRPLAKELGIRVVPTFKI KD KV KEVTGAK D+L AIE S+ Sbjct: 125 DCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSA 175
>TRXF2_ARATH (Q9XFH9) Thioredoxin F-type 2, chloroplast precursor (TRX-F2)| Length = 185 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXS 213 DCNQDN+PLAKELGIRVVPTFKI KD KV KEVTGAK ++L AIE S Sbjct: 135 DCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARS 184
>TRXF_PEA (P29450) Thioredoxin F-type, chloroplast precursor (TRX-F)| Length = 182 Score = 78.6 bits (192), Expect = 4e-15 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 DCNQDN+ LAKELGI+VVPTFKI KD K+ KEVTGAK D+L AI+ V SS Sbjct: 132 DCNQDNKSLAKELGIKVVPTFKILKDNKIVKEVTGAKFDDLVAAIDTVRSS 182
>TRXF_MESCR (O81332) Thioredoxin F-type, chloroplast precursor (TRX-F)| Length = 191 Score = 77.8 bits (190), Expect = 6e-15 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 DCNQ+N+PLAKELGIRVVPTFKI K GK+ EVTGAK D+L AIE SS Sbjct: 141 DCNQENKPLAKELGIRVVPTFKILKGGKIVDEVTGAKFDKLVAAIEAARSS 191
>TRXF_BRANA (O48897) Thioredoxin F-type, chloroplast precursor (TRX-F)| Length = 182 Score = 77.0 bits (188), Expect = 1e-14 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 DCN +NRPLAKELGIRVVPTFKI KD +V KEVTGAK D+L AIE S+ Sbjct: 128 DCNPENRPLAKELGIRVVPTFKILKDNQVVKEVTGAKYDDLVAAIETARSA 178
>TRXF_SPIOL (P09856) Thioredoxin F-type, chloroplast precursor (TRX-F)| Length = 190 Score = 70.1 bits (170), Expect = 1e-12 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 DCNQ+N+ LAKELGIRVVPTFKI K+ V EVTGAK D+L AI+ SS Sbjct: 140 DCNQENKTLAKELGIRVVPTFKILKENSVVGEVTGAKYDKLLEAIQAARSS 190
>TRXH_PICMA (O65049) Thioredoxin H-type (TRX-H)| Length = 125 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 R +A+E + +PTF KDGK +V GAK D+L R + + ++ Sbjct: 69 RDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKVAALAAA 113
>THIO_EMENI (P29429) Thioredoxin| Length = 109 Score = 38.1 bits (87), Expect = 0.005 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIE 225 +A ELGIR +PTF +FKDG+ +V GA L I+ Sbjct: 68 VAAELGIRAMPTFLLFKDGQKVSDVVGANPGALEAGIK 105
>TRXH2_TOBAC (Q07090) Thioredoxin H-type 2 (TRX-H2)| Length = 118 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS 210 + +A + + +PTF K+GK+ +V GAK DEL + I + SS Sbjct: 70 KSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHISS 114
>TRXH2_BRANA (Q39362) Thioredoxin H-type 2 (TRX-H-2)| Length = 119 Score = 36.2 bits (82), Expect = 0.020 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 +A+E G+ +PTF + KDG V +V GA+ ++L I Sbjct: 74 VAQEFGVEAMPTFVLIKDGNVVDKVVGARKEDLHATI 110
>TRXH_RICCO (Q43636) Thioredoxin H-type (TRX-H)| Length = 118 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 + +A E + +PTF K+GK+ +V GAK DEL + I Sbjct: 71 KTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTI 109
>TRXH1_ARATH (P29448) Thioredoxin H-type 1 (TRX-H-1)| Length = 114 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 + +A + I+ +PTF K+GK+ +V GAK DEL I Sbjct: 71 KSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTI 109
>TRXH2_ARATH (Q38879) Thioredoxin H-type 2 (TRX-H-2)| Length = 133 Score = 35.8 bits (81), Expect = 0.026 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEV 219 +AKE + +PTF + K GK + + GAK DEL + + ++ Sbjct: 92 VAKEFNVTAMPTFVLVKRGKEIERIIGAKKDELEKKVSKL 131
>THIO1_CORNE (P00275) Thioredoxin C-1| Length = 105 Score = 35.0 bits (79), Expect = 0.045 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 +N LA + G+R +PT +FKDG++A + GA Sbjct: 60 ENPELAAQFGVRSIPTLLMFKDGELAANMVGA 91
>THIO_CHLAU (Q7M1B9) Thioredoxin (TRX)| Length = 109 Score = 35.0 bits (79), Expect = 0.045 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 DN A +LG++ +PT IFKDG+ + GA+ + + R I Sbjct: 61 DNVQYASQLGLKGLPTLVIFKDGREVGRLVGARPEAMYREI 101
>THIO_CYACA (P37395) Thioredoxin| Length = 107 Score = 34.3 bits (77), Expect = 0.077 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P ++ E GIR +PT +FKDGK V GA Sbjct: 59 NTDENPSISAEYGIRSIPTLMLFKDGKRVDTVIGA 93
>TRX3_YEAST (P25372) Thioredoxin 3, mitochondrial precursor| Length = 127 Score = 33.9 bits (76), Expect = 0.10 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = -3 Query: 359 CNQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEV 219 C+ D P +AKE + +PTF + KDG++ ++ GA L + I+++ Sbjct: 80 CDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL 127
>THIO1_SYNP7 (P12243) Thioredoxin 1 (TRX-1) (Thioredoxin M)| Length = 106 Score = 33.9 bits (76), Expect = 0.10 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P +A + GIR +PT IFKDG+ V GA Sbjct: 58 NTDENPSVASQYGIRSIPTLMIFKDGQRVDTVVGA 92
>THIO_PORPU (P51225) Thioredoxin| Length = 107 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 DN +A E GIR +PT IFK G+ V GA Sbjct: 61 DNPTIAAEYGIRSIPTLMIFKSGERVDTVIGA 92
>TRXH1_TOBAC (P29449) Thioredoxin H-type 1 (TRX-H1)| Length = 126 Score = 33.5 bits (75), Expect = 0.13 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 + ++ E + +PTF KDGK V GAK +EL + I Sbjct: 77 KTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTI 115
>TRXM_CHLRE (P23400) Thioredoxin M-type, chloroplast precursor (TRX-M)| (Thioredoxin CH2) Length = 140 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P +A E GIR +PT +FK GK + + GA Sbjct: 91 NTDESPNVASEYGIRSIPTIMVFKGGKKCETIIGA 125
>TRXH_FAGES (Q96419) Thioredoxin H-type (TRX-H)| Length = 116 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 D + +A+E + +P+F I K+G+ + + GA+ DEL I Sbjct: 68 DLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKI 108
>TRXL4_ARATH (Q8LDI5) Thioredoxin-like 4| Length = 118 Score = 33.1 bits (74), Expect = 0.17 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIE 225 + +A +L ++ +PTF KDG ++ GA DE+ + ++ Sbjct: 67 KEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRVD 106
>TRXH_CHLRE (P80028) Thioredoxin H-type (TRX-H) (Thioredoxin CH1)| Length = 112 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDEL 240 +A+ GI +PTF ++KDG A ++ GA D+L Sbjct: 70 VAEAAGITAMPTFHVYKDGVKADDLVGASQDKL 102
>THIO_CHICK (P08629) Thioredoxin| Length = 104 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/44 (29%), Positives = 27/44 (61%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEV 219 D + +A ++ +PTF+ +K+GK +E +GA ++L I+ + Sbjct: 60 DAQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSL 103
>THIO_CHLCV (P52227) Thioredoxin (TRX)| Length = 102 Score = 32.7 bits (73), Expect = 0.22 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -3 Query: 356 NQDNRPL-AKELGIRVVPTFKIFKDGKVAKEVTGAK-IDELARAIEE 222 N D+ P A++ G+ +PT +FKDGK V G K D L R I + Sbjct: 54 NIDDHPAPAEQYGVSSIPTLILFKDGKEVDRVVGLKDKDSLIRLINQ 100
>THIO_STRAU (P33791) Thioredoxin (TRX) (Fragment)| Length = 106 Score = 32.7 bits (73), Expect = 0.22 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P LA + G+R +PT +FK G+VA + GA Sbjct: 58 NTDENPQLASQYGVRSIPTRLMFKGGEVAANMVGA 92
>THIO_COPCM (Q9UW02) Thioredoxin (Allergen Cop c 2)| Length = 106 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEE 222 +++E IR +PTF+++KDG+ E+ GA L +++ Sbjct: 65 ISEEAKIRAMPTFQVYKDGQKIDELVGANPTALESLVQK 103
>TRXH_ORYSA (Q42443) Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein 1)| Length = 122 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 + +A++ + +PTF KDG A +V GA+ D+L I Sbjct: 71 KEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTI 109
>THIO_PORYE (P50254) Thioredoxin| Length = 107 Score = 32.7 bits (73), Expect = 0.22 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 DN +A E GIR +PT IFK G+ V GA Sbjct: 61 DNPTIAAEYGIRSIPTLMIFKAGERVDTVIGA 92
>TRXH4_ARATH (Q39239) Thioredoxin H-type 4 (TRX-H-4)| Length = 119 Score = 32.3 bits (72), Expect = 0.29 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 +AKE G+ +PTF K G+V ++ GA ++L I Sbjct: 74 VAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKI 110
>TRXH_WHEAT (O64394) Thioredoxin H-type (TRX-H) (TrxTa)| Length = 126 Score = 32.3 bits (72), Expect = 0.29 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 +P+A++ + +PTF K+G V V GA +EL + Sbjct: 82 KPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKV 120
>THIO2_SHIFL (P0AGG7) Thioredoxin 2 (EC 1.8.1.8) (Protein-disulfide reductase)| (Disulfide reductase) (Trx2) Length = 139 Score = 32.0 bits (71), Expect = 0.38 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 R L+ GIR +PT IFK+G+V + GA Sbjct: 96 RELSSRFGIRSIPTIMIFKNGQVVDMLNGA 125
>THIO2_ECOLI (P0AGG4) Thioredoxin 2 (EC 1.8.1.8) (Protein-disulfide reductase)| (Disulfide reductase) (Trx2) Length = 139 Score = 32.0 bits (71), Expect = 0.38 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 R L+ GIR +PT IFK+G+V + GA Sbjct: 96 RELSSRFGIRSIPTIMIFKNGQVVDMLNGA 125
>THIO2_ECOL6 (P0AGG5) Thioredoxin 2 (EC 1.8.1.8) (Protein-disulfide reductase)| (Disulfide reductase) (Trx2) Length = 139 Score = 32.0 bits (71), Expect = 0.38 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 R L+ GIR +PT IFK+G+V + GA Sbjct: 96 RELSSRFGIRSIPTIMIFKNGQVVDMLNGA 125
>THIO2_ECO57 (P0AGG6) Thioredoxin 2 (EC 1.8.1.8) (Protein-disulfide reductase)| (Disulfide reductase) (Trx2) Length = 139 Score = 32.0 bits (71), Expect = 0.38 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 R L+ GIR +PT IFK+G+V + GA Sbjct: 96 RELSSRFGIRSIPTIMIFKNGQVVDMLNGA 125
>THIO_GRIPA (P50338) Thioredoxin| Length = 109 Score = 31.6 bits (70), Expect = 0.50 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P +A E GIR +PT IF +GK V GA Sbjct: 58 NTDQNPTIATEYGIRSIPTVMIFINGKKVDTVVGA 92
>THIO_STRCO (P52230) Thioredoxin (TRX)| Length = 110 Score = 31.6 bits (70), Expect = 0.50 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 +N A + G+ +PT +++ G+VAK + GAK Sbjct: 63 ENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAK 95
>THIO_PASMU (Q9CM49) Thioredoxin (TRX)| Length = 106 Score = 31.6 bits (70), Expect = 0.50 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGK-VAKEVTGAKIDELARAIEE 222 +N+ +LG+R +PT +FK+GK VA +V ++LA I + Sbjct: 61 ENQATPAQLGVRSIPTLVLFKNGKAVATQVGALPKNQLANFINQ 104
>THIO_RHORU (P10473) Thioredoxin (TRX)| Length = 104 Score = 31.2 bits (69), Expect = 0.65 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 +N + G+R +PT IFKDG+VA GA Sbjct: 59 ENPQTPSKYGVRGIPTLMIFKDGQVAATKIGA 90
>PDI_MAIZE (P52588) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| Length = 513 Score = 31.2 bits (69), Expect = 0.65 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = -3 Query: 362 DCNQD-NRPLAKELGIRVVPTFKIFKD-GKVAKEVTGAK 252 D N++ NRPLA + I+ PT KIF+D GK +E G + Sbjct: 93 DANEEKNRPLATKYEIQGFPTIKIFRDRGKNIQEYKGPR 131
>TRXM_WHEAT (Q9ZP21) Thioredoxin M-type, chloroplast precursor (TRX-M)| Length = 175 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D+ P +A GIR +PT +FKDG+ + V GA Sbjct: 125 NTDDCPNIASTYGIRSIPTVLMFKDGEKKESVIGA 159
>THIO1_ANASP (P0A4L1) Thioredoxin 1 (TRX-1) (Thioredoxin M)| Length = 106 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P +A + GIR +PT IFK G+ V GA Sbjct: 58 NTDENPQVASQYGIRSIPTLMIFKGGQKVDMVVGA 92
>THIO1_ANASO (P0A4L2) Thioredoxin 1 (TRX-1) (Thioredoxin M)| Length = 106 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P +A + GIR +PT IFK G+ V GA Sbjct: 58 NTDENPQVASQYGIRSIPTLMIFKGGQKVDMVVGA 92
>THIO_PSEAE (Q9X2T1) Thioredoxin (TRX)| Length = 108 Score = 31.2 bits (69), Expect = 0.65 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 D NQD P + G+R +PT +FKDG V GA Sbjct: 62 DENQDTPP---KYGVRGIPTLMLFKDGNVEATKVGA 94
>THIO_SCHPO (O14463) Thioredoxin (TR)| Length = 102 Score = 30.8 bits (68), Expect = 0.85 Identities = 12/38 (31%), Positives = 25/38 (65%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIE 225 +A E G+ +P+F ++K+G+ +E+ GA +L +I+ Sbjct: 62 IAAEAGVHAMPSFFLYKNGEKIEEIVGANPAKLEASIK 99
>TRXH3_ARATH (Q42403) Thioredoxin H-type 3 (TRX-H-3)| Length = 118 Score = 30.8 bits (68), Expect = 0.85 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEE 222 +A+E ++ +PTF K+G++ + V GA +E+ +E+ Sbjct: 72 VAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110
>THIO2_CHLTE (Q8KE49) Thioredoxin 2 (Trx-2)| Length = 108 Score = 30.8 bits (68), Expect = 0.85 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT I K GKV ++ GA Sbjct: 59 NVDENPNTAGQYGIRSIPTMLIIKGGKVVDQMVGA 93
>DYL4_CHLRE (Q39591) Dynein 14 kDa light chain, flagellar outer arm| Length = 129 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -3 Query: 332 KELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS*AMP*KNAA 183 KE + P F FKDGK +++ G K +L R + E+ P AA Sbjct: 70 KEYVGKCKPIFLFFKDGKQVEKIEGVKAPQLNRIVTELSGKNPPPAAPAA 119
>TRXM_ORYSA (Q9ZP20) Thioredoxin M-type, chloroplast precursor (TRX-M)| Length = 172 Score = 30.4 bits (67), Expect = 1.1 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA-KIDELARAIEEVXSS 210 N D+ P +A GIR +PT +FK+G+ + V GA LA I++ SS Sbjct: 122 NTDDSPNIATNYGIRSIPTVLMFKNGEKKESVIGAVPKTTLATIIDKYVSS 172
>TRXM_MAIZE (Q41864) Thioredoxin M-type, chloroplast precursor (TRX-M)| Length = 167 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D+ P +A GIR +PT IFK G+ + V GA Sbjct: 116 NTDDSPNVASTYGIRSIPTVLIFKGGEKKESVIGA 150
>THIO_CHLMU (Q9PJK3) Thioredoxin (TRX)| Length = 102 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK-IDELARAIEE 222 D + RP A++ G+ +PT +FKDGK + G K D L + I + Sbjct: 54 DIDASPRP-AEQFGVSSIPTLILFKDGKEVERSVGLKDKDSLVKLISK 100
>TRXM3_ARATH (Q9SEU7) Thioredoxin M-type 3, chloroplast precursor (TRX-M3)| Length = 173 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -3 Query: 356 NQDNR-PLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDEL-ARAIEEVXSS 210 N DN P+A+E I+ VP +FK+G+ + + G E AIE V +S Sbjct: 123 NADNDLPVAEEYEIKAVPVVLLFKNGEKRESIMGTMPKEFYISAIERVLNS 173
>TRXH5_ARATH (Q39241) Thioredoxin H-type 5 (TRX-H-5)| Length = 118 Score = 30.0 bits (66), Expect = 1.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDEL 240 +A+E + +PTF K+G + V GA DE+ Sbjct: 72 VAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEI 104
>THIO_STRCL (Q05739) Thioredoxin (TRX)| Length = 107 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 356 NQDNRPL-AKELGIRVVPTFKIFKDGKVAKEVTGAK 252 N D P A + G+ +PT +++ G+V K + GAK Sbjct: 59 NIDQNPATAAKYGVMSIPTLNVYQGGEVVKTIVGAK 94
>PDIA6_MESAU (P38660) Protein disulfide-isomerase A6 precursor (EC 5.3.4.1)| (Protein disulfide isomerase P5) Length = 439 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKI--DELARAIE 225 N+ LA GIR PT KIF+ G+ + G + D ++RA++ Sbjct: 225 NQVLANRYGIRGFPTIKIFQKGEAPVDYDGGRTRSDIVSRALD 267
>GSBP_CHICK (P12244) Dolichyl-diphosphooligosaccharide--protein| glycotransferase precursor (EC 2.4.1.119) (Glycosylation site-binding chain) (GSBP) Length = 508 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K FK+G A KE T G + D++ +++ Sbjct: 89 LAQQYGVRAYPTIKFFKNGDTASPKEYTAGREADDIVNWLKK 130
>IL21R_HUMAN (Q9HBE5) Interleukin-21 receptor precursor (IL-21R) (Novel| interleukin receptor) Length = 538 Score = 30.0 bits (66), Expect = 1.4 Identities = 9/29 (31%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = -2 Query: 108 WRKTVIIVLLLMMIY-QSFWTIYTHTMWQ 25 W ++++LLL++++ +FW++ TH +W+ Sbjct: 234 WNPHLLLLLLLVIVFIPAFWSLKTHPLWR 262
>THIO_SYNY3 (P52231) Thioredoxin (TRX)| Length = 106 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT IFK G+ V GA Sbjct: 58 NTDENPNTASQYGIRSIPTLMIFKGGQRVDMVVGA 92
>THIO_SHIFL (P0AA30) Thioredoxin 1 (TRX1) (TRX)| Length = 108 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT +FK+G+VA GA Sbjct: 59 NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGA 93
>THIO_SALTY (P0AA28) Thioredoxin 1 (TRX1) (TRX)| Length = 108 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT +FK+G+VA GA Sbjct: 59 NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGA 93
>THIO_SALTI (P0AA29) Thioredoxin 1 (TRX1) (TRX)| Length = 108 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT +FK+G+VA GA Sbjct: 59 NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGA 93
>THIO_ECOLI (P0AA25) Thioredoxin 1 (TRX1) (TRX)| Length = 108 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT +FK+G+VA GA Sbjct: 59 NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGA 93
>THIO_ECOL6 (P0AA26) Thioredoxin 1 (TRX1) (TRX)| Length = 108 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT +FK+G+VA GA Sbjct: 59 NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGA 93
>THIO_ECO57 (P0AA27) Thioredoxin 1 (TRX1) (TRX)| Length = 108 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT +FK+G+VA GA Sbjct: 59 NIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGA 93
>CFTR_PONPY (Q2IBE4) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1480 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIAR------ANSSIFAPVTSLATF 282 TST + F+ V +D++L FF+G+ + ++++ +S + AP+++L T Sbjct: 908 TSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHNKMLHSVLQAPMSTLNTL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KAGGILN 974
>CFTR_PANTR (Q2QLE5) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1480 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIAR------ANSSIFAPVTSLATF 282 TST + F+ V +D++L FF+G+ + ++++ +S + AP+++L T Sbjct: 908 TSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KAGGILN 974
>CFTR_HUMAN (P13569) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1480 Score = 29.6 bits (65), Expect = 1.9 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIAR------ANSSIFAPVTSLATF 282 TST + F+ V +D++L FF+G+ + ++++ +S + AP+++L T Sbjct: 908 TSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KAGGILN 974
>TXNL2_MOUSE (Q9CQM9) Thioredoxin-like protein 2 (PKC-interacting cousin of| thioredoxin) (PKC-theta-interacting protein) (PKCq-interacting protein) Length = 337 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS*AMP 198 ++++ I VPTF FK+ + + GA EL + ++ SS A P Sbjct: 78 VSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFP 124
>YBBN_ECOLI (P77395) Protein ybbN| Length = 284 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 DC+ + +A + G+R +PT +F++G+ G + +E RA+ Sbjct: 62 DCDAEQM-IAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRAL 105
>PDIA6_PONPY (Q5R6T1) Protein disulfide-isomerase A6 precursor (EC 5.3.4.1)| Length = 440 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKI--DELARAIE 225 N+ LA GIR PT KIF+ G+ + G + D ++RA++ Sbjct: 225 NQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALD 267
>PDIA6_HUMAN (Q15084) Protein disulfide-isomerase A6 precursor (EC 5.3.4.1)| (Protein disulfide isomerase P5) (Thioredoxin domain-containing protein 7) Length = 440 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKI--DELARAIE 225 N+ LA GIR PT KIF+ G+ + G + D ++RA++ Sbjct: 225 NQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALD 267
>PDIA1_RAT (P04785) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone-binding protein) Length = 509 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K FK+G A KE T G + D++ +++ Sbjct: 92 LAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKK 133
>PDIA1_RABIT (P21195) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone-binding protein) (p55) Length = 509 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K FK+G A KE T G + D++ +++ Sbjct: 91 LAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKK 132
>PDIA1_MOUSE (P09103) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone-binding protein) (p55) (Erp59) Length = 509 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K FK+G A KE T G + D++ +++ Sbjct: 92 LAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKK 133
>PDIA1_CRIGR (Q8R4U2) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) (p58) Length = 509 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K FK+G A KE T G + D++ +++ Sbjct: 92 LAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKK 133
>THIO_CYAME (O22022) Thioredoxin| Length = 102 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P LA GIR +PT +FK G+ V GA Sbjct: 54 NTDENPNLATFYGIRSIPTLMLFKKGQRVDTVIGA 88
>THIO_MYCSM (O30974) Thioredoxin (TRX)| Length = 112 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 N A++ + +PT +FKDG K + GAK Sbjct: 68 NPATARDFQVVSIPTMILFKDGAPVKRIVGAK 99
>PDIA1_BOVIN (P05307) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone-binding protein) (p55) Length = 510 Score = 28.9 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K FK+G A KE T G + D++ +++ Sbjct: 92 LAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKK 133
>PDI1_SCHPO (Q10057) Putative protein disulfide-isomerase C1F5.02 precursor (EC| 5.3.4.1) Length = 492 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 DC ++ L E IR PT +FK+GK + +G + Sbjct: 79 DCTEEG-DLCSEYSIRGYPTLNVFKNGKQISQYSGPR 114
>THIO_MYCTU (P0A616) Thioredoxin (TRX) (MPT46)| Length = 115 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 N A+ + +PT +FKDG+ K + GAK Sbjct: 67 NPETARNFQVVSIPTLILFKDGQPVKRIVGAK 98
>THIO_MYCBO (P0A617) Thioredoxin (TRX) (MPT46)| Length = 115 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 N A+ + +PT +FKDG+ K + GAK Sbjct: 67 NPETARNFQVVSIPTLILFKDGQPVKRIVGAK 98
>TXNL2_RAT (Q9JLZ1) Thioredoxin-like 2 protein (PKC-interacting cousin of| thioredoxin) (PKCq-interacting protein) (PKC-theta-interacting protein) Length = 337 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS*AMP 198 ++++ I VPTF FK+ + + GA EL + ++ SS + P Sbjct: 78 VSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGSFP 124
>PDIA6_RAT (Q63081) Protein disulfide-isomerase A6 precursor (EC 5.3.4.1)| (Protein disulfide isomerase P5) (Calcium-binding protein 1) (CaBP1) (Thioredoxin domain-containing protein 7) Length = 440 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKI--DELARAIE 225 N+ LA GI+ PT KIF+ G+ + G + D ++RA++ Sbjct: 225 NQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALD 267
>PDIA6_MOUSE (Q922R8) Protein disulfide-isomerase A6 precursor (EC 5.3.4.1)| (Thioredoxin domain-containing protein 7) Length = 440 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKI--DELARAIE 225 N+ LA GI+ PT KIF+ G+ + G + D ++RA++ Sbjct: 225 NQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALD 267
>KZ_DROME (O46072) Probable ATP-dependent RNA helicase kurz (EC 3.6.1.-)| Length = 1192 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEE 222 + NQ R L + PT + K+GKV++E ID+ A +E+ Sbjct: 487 EVNQLVRKLRRTFPYHHAPTKDVAKNGKVSEEEKEETIDDAASTVED 533
>TRXM4_ARATH (Q9SEU6) Thioredoxin M-type 4, chloroplast precursor (TRX-M4)| Length = 193 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A GIR VPT IFK G+ + GA Sbjct: 143 NTDESPNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177
>THIO_HAEIN (P43785) Thioredoxin (TRX)| Length = 107 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGA 255 DN+ + G+R +PT + K+G+V GA Sbjct: 62 DNQATPAQFGVRSIPTLLLIKNGQVVATQVGA 93
>THIO_BACSU (P14949) Thioredoxin (TRX)| Length = 103 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDE 243 +N+ A + G+ +PT + KDG+V + G K E Sbjct: 58 ENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKE 93
>TXND9_HUMAN (O14530) Thioredoxin domain-containing protein 9 (Protein 1-4) (ATP| binding protein associated with cell differentiation) Length = 226 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTG 258 L + L I+V+PT + KDGK V G Sbjct: 134 LCERLHIKVIPTLALLKDGKTQDYVVG 160
>THIO_TREPA (O83889) Thioredoxin (TRX)| Length = 105 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGK 279 D++ LA E + +PT +FKDGK Sbjct: 60 DDQDLAVEFNVASIPTLIVFKDGK 83
>SYD_BIFLO (Q8G863) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 599 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -3 Query: 344 RPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAIEEVXSS*AMP 198 RPL E I++ ++ DG + KI+ +A IE + S A+P Sbjct: 61 RPLRSEFVIQITGEVRLRPDGNENTHLATGKIEVVAETIEILAKSDALP 109
>THIO_HELPY (P66928) Thioredoxin (TRX)| Length = 106 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 + L+ + GIR +PT KDG+V ++ G + Sbjct: 60 EQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQ 92
>THIO_HELPJ (P66929) Thioredoxin (TRX)| Length = 106 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 + L+ + GIR +PT KDG+V ++ G + Sbjct: 60 EQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQ 92
>RL10_STRT2 (Q5M5F2) 50S ribosomal protein L10| Length = 167 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 293 FKDGKVAKEVTGAKIDELARAIEEVXSS*AMP*KNAAISML 171 F G A E+ G +D ++EE+ + ++P K +SML Sbjct: 100 FAKGAEALEIKGGVVDGAITSVEEINALASLPNKEGMLSML 140
>RL10_STRT1 (Q5M0W5) 50S ribosomal protein L10| Length = 167 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 293 FKDGKVAKEVTGAKIDELARAIEEVXSS*AMP*KNAAISML 171 F G A E+ G +D ++EE+ + ++P K +SML Sbjct: 100 FAKGAEALEIKGGVVDGAITSVEEINALASLPNKEGMLSML 140
>TRXB_MYCLE (P46843) Bifunctional thioredoxin reductase/thioredoxin [Includes:| Thioredoxin reductase (EC 1.8.1.9) (TRXR); Thioredoxin] Length = 458 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 347 NRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 N +A+E + +PT +F+ G+ K + GAK Sbjct: 410 NPEMAREFQVVSIPTMILFQGGQPVKRIVGAK 441
>TRXL6_ARATH (Q8LCT3) Thioredoxin-like 6, chloroplast precursor| Length = 236 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -3 Query: 350 DNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKIDELARAI 228 +N+P+ K L +RV+P F ++ E + ++ +AI Sbjct: 164 ENKPMCKSLNVRVLPFFHFYRGADGQLESFSCSLAKVKKAI 204
>SOS2_HUMAN (Q07890) Son of sevenless homolog 2 (SOS-2)| Length = 1332 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 11/52 (21%) Frame = -1 Query: 136 HPLWKWMITVEKNSYYSSSAYDDLPIVLDNIHP-----------YHVAVYAV 14 HP+ KW I +++ + L + +D IHP YHV++Y V Sbjct: 80 HPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIV 131
>PDIA1_PONPY (Q5R5B6) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) Length = 508 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K F++G A KE T G + D++ +++ Sbjct: 90 LAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKK 131
>PDIA1_HUMAN (P07237) Protein disulfide-isomerase precursor (EC 5.3.4.1) (PDI)| (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone-binding protein) (p55) Length = 508 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVA--KEVT-GAKIDELARAIEE 222 LA++ G+R PT K F++G A KE T G + D++ +++ Sbjct: 90 LAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKK 131
>BS2_TRYBB (P12865) Bloodstream-specific protein 2 precursor| Length = 497 Score = 27.7 bits (60), Expect = 7.2 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAKI-DELARAIEEVXSS*AMP*KNA 186 DC+ LA IR PT +F++GK A+ GA+ D++ + I+ P NA Sbjct: 75 DCHSQPE-LAANFSIRGYPTIILFRNGKEAEHYGGARTKDDIIKYIKANVGPAVTPASNA 133
>CFTR_MICMU (Q2QL83) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1481 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIAR------ANSSIFAPVTSLATF 282 TST + F+ V +D++L FF+G+ + ++++ +S + AP+++L Sbjct: 908 TSTSAYYVFYIYVGVADTLLALGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNAL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KAGGILN 974
>SOS2_MOUSE (Q02384) Son of sevenless homolog 2 (SOS-2) (mSOS-2) (Fragment)| Length = 1297 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 11/52 (21%) Frame = -1 Query: 136 HPLWKWMITVEKNSYYSSSAYDDLPIVLDNIHP-----------YHVAVYAV 14 HP+ KW I +++ + L + +D IHP YHV++Y V Sbjct: 45 HPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYHVSLYIV 96
>FIMA3_PORGI (Q51826) Major fimbrial subunit protein type-3 precursor (Major| fimbrial subunit protein type III) (Fimbrillin) (Fimbrilin) Length = 353 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -2 Query: 240 SACD*GSXVKLSNALKKCSN*HAITSVHYGMKVENTLCGSG*SPWRKTVIIV 85 +A D KL+ + K AI SV +KVEN CG+G ++T++++ Sbjct: 14 NAGDEAKVAKLTVMVYKGEQQEAIKSVENAIKVENIKCGAG----QRTLVVM 61
>THIO_CHLTR (O84544) Thioredoxin (TRX)| Length = 102 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 362 DCNQDNRPLAKELGIRVVPTFKIFKDGKVAKEVTGAK 252 D + RP A++ + +PT +FKDGK + G K Sbjct: 54 DIDSSPRP-AEQYSVSSIPTLILFKDGKEVERSVGLK 89
>TRXM_PEA (P48384) Thioredoxin M-type, chloroplast precursor (TRX-M)| Length = 172 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -3 Query: 356 NQDNRP-LAKELGIRVVPTFKIFKDGKVAKEVTGA 255 N D P A + GIR +PT FK+G+ V GA Sbjct: 124 NTDESPNTATKYGIRSIPTVLFFKNGERKDSVIGA 158
>LOLA4_DROME (Q867Z4) Longitudinals lacking protein, isoforms F/I/K/T| Length = 970 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 7 HHLQHTLPHGMGVYCPERLVNHHKQKNYNNCFSPR*SSTSTEGVFNFHP 153 HH QH H V P+ HH+Q++++ + + + T + + HP Sbjct: 613 HHQQHQTIHIEEV--PQTSQQHHQQQHHHQLQTVQPTHTQVQSIITAHP 659
>CFTR_SHEEP (Q00555) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1481 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIARA------NSSIFAPVTSLATF 282 TST + F+ V +D++L F+G+ + ++++ S + AP+++L T Sbjct: 908 TSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KTGGILN 974
>CFTR_HORSE (Q2QLA3) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1481 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIAR------ANSSIFAPVTSLATF 282 TST + F+ V +D++L F+G+ + ++++ +S + AP+++L T Sbjct: 908 TSTSSYYVFYIYVGVADTLLALGLFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KAGGILN 974
>CFTR_BOVIN (P35071) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1481 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 6/67 (8%) Frame = +1 Query: 121 TSTEGVFNFHPIVYTSDSMLIAAFFQGIAQLDXTSSIARA------NSSIFAPVTSLATF 282 TST + F+ V +D++L F+G+ + ++++ S + AP+++L T Sbjct: 908 TSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTL 967 Query: 283 PSLKILN 303 + ILN Sbjct: 968 KTGGILN 974
>TXND9_BOVIN (O18883) Thioredoxin domain-containing protein 9 (Protein 1-4)| (Fragment) Length = 179 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 338 LAKELGIRVVPTFKIFKDGKVAKEVTG 258 L + L I+V+PT + KDGK V G Sbjct: 64 LCERLRIKVIPTLALVKDGKTQDFVVG 90
>TPBG_MOUSE (Q9Z0L0) Trophoblast glycoprotein precursor (5T4 oncofetal| trophoblast glycoprotein) (5T4 oncotrophoblast glycoprotein) Length = 426 Score = 27.3 bits (59), Expect = 9.4 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 169 DSMLIAAFFQGIAQLDXTSSIARANSSIFAPVTSLATFPSLKILNV-GTTLMPSSFAS 339 + M+ AA G+A T +N +F P LA PSL+ L++ +L+ ++AS Sbjct: 202 EGMVAAALRSGLALRGLTRLELASNHFLFLPRDLLAQLPSLRYLDLRNNSLVSLTYAS 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,139,800 Number of Sequences: 219361 Number of extensions: 860559 Number of successful extensions: 2438 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 2408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2438 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
