| Clone Name | rbaal24l19 |
|---|---|
| Clone Library Name | barley_pub |
>ATRN_MOUSE (Q9WU60) Attractin precursor (Mahogany protein)| Length = 1428 Score = 32.0 bits (71), Expect = 0.38 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 270 KLKCLQNLYKAPQRQPVESFKGNVYP 193 K KC++ YK P + P ++ GNVYP Sbjct: 1012 KGKCIEGSYKGPVKMPSQASAGNVYP 1037
>ATRN_RAT (Q99J86) Attractin precursor (Zitter protein)| Length = 1432 Score = 31.2 bits (69), Expect = 0.64 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 270 KLKCLQNLYKAPQRQPVESFKGNVYP 193 K KC++ YK P + P + GNVYP Sbjct: 1016 KGKCIEGSYKGPVKMPSHASTGNVYP 1041
>ATRN_HUMAN (O75882) Attractin precursor (Mahogany homolog) (DPPT-L)| Length = 1429 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 270 KLKCLQNLYKAPQRQPVESFKGNVYP 193 K KC++ YK P + P ++ GN YP Sbjct: 1013 KGKCIEGSYKGPVKMPSQAPTGNFYP 1038
>UL48_HCMVA (P16785) Probable large tegument protein| Length = 2241 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 142 HPRIKILIHREGFIRFRRINIALERFHWLSLR 237 HP+++ ++ R+ R R IN L FH L +R Sbjct: 811 HPQLREMLRRDEQTRLRLINAVLSMFHTLVMR 842
>HV1E_HUMAN (P01761) Ig heavy chain V-I region SIE| Length = 124 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 271 EVKMPSKSIQSTAKTTSGIFQGQCLS 194 EVK P S++ T KT+ G F G +S Sbjct: 10 EVKKPGSSVRVTCKTSGGTFSGYTIS 35
>NAS28_CAEEL (P98061) Zinc metalloproteinase nas-28 precursor (EC 3.4.24.21)| (Nematode astacin 28) Length = 497 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 337 RREKIGHTASFWRFSVAFYPNLEVKMPSKSIQSTAKTTSGIFQGQCLS 194 +R+ I T +FW SV + + K+ + +I + K CLS Sbjct: 119 KRQAIVDTTNFWSVSVPIFYQFDTKLSATNIANVRKAIQFWNDNSCLS 166
>AROG_SOLTU (P37822) Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplast| precursor (EC 2.5.1.54) (Phospho-2-keto-3-deoxyheptonate aldolase 2) (DAHP synthetase 2) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 2) Length = 511 Score = 27.3 bits (59), Expect = 9.3 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Frame = -1 Query: 318 ILLLFGGSP*LSIPILKLKCLQNLYKAPQRQPVESFKGNVYPAESYETFPVNQNL---DS 148 ++L+FGG +P++K+ + + P+ P+E G P SY+ +N + S Sbjct: 150 VVLMFGGQ----VPVIKVGRMAGQFAKPRSDPLEEINGVKLP--SYKGDNINGDTFDEKS 203 Query: 147 RVP 139 R+P Sbjct: 204 RIP 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,365,119 Number of Sequences: 219361 Number of extensions: 940885 Number of successful extensions: 1950 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1950 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)