| Clone Name | rbaal25a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRD16_HUMAN (Q9HAZ2) PR domain zinc finger protein 16 (PR domain... | 30 | 6.9 | 2 | PGP2_SULSO (P95931) Phosphoglycolate phosphatase 2 (EC 3.1.3.18)... | 30 | 6.9 | 3 | CYAA_NEUCR (Q01631) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophos... | 29 | 9.0 |
|---|
>PRD16_HUMAN (Q9HAZ2) PR domain zinc finger protein 16 (PR domain-containing| protein 16) (Transcription factor MEL1) Length = 1276 Score = 29.6 bits (65), Expect = 6.9 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 86 PFPFHPISYKASPDPXTTRPSL--GASKSACLRCGHMTNGSADL 211 P P HP +++ SP P + P L G + C CG + SA+L Sbjct: 924 PLPHHPFNFR-SPPPTLSDPILRKGKERYTCRYCGKIFPRSANL 966
>PGP2_SULSO (P95931) Phosphoglycolate phosphatase 2 (EC 3.1.3.18) (PGPase 2)| (PGP 2) Length = 233 Score = 29.6 bits (65), Expect = 6.9 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 1/88 (1%) Frame = -3 Query: 559 SPALTQQEQEMLRDVKYRKFVPGISKSQEF-DTKARHMKQSRLIKSNSHSPSSGNRKEFL 383 SP ++Q+ E + KY KFV + ++F D A +K + I N +R+ L Sbjct: 28 SPIVSQKVNEFSK--KY-KFVVVTGREKKFIDKLAVGLKPTAWILENGSLILFNDREFVL 84 Query: 382 SIRSLLPVIDFEIDRTKALDMIDNLKVQ 299 +S FE DR K ++++DNLKV+ Sbjct: 85 CEKSW-----FERDRKKIIEILDNLKVR 107
>CYAA_NEUCR (Q01631) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2300 Score = 29.3 bits (64), Expect = 9.0 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 92 PFHPISYKASPDPXTTRPSLGASKSACLRCGHMTNGSADLMYTSS 226 P H K++ DP +PSL SA NGS+ +M T S Sbjct: 477 PGHHKHNKSNEDPRALKPSLSREDSAASFARDFRNGSSSMMGTRS 521 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,231,445 Number of Sequences: 219361 Number of extensions: 1774975 Number of successful extensions: 4641 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4639 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)