| Clone Name | rbaal24j20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y436_MYCPN (P75342) Hypothetical lipoprotein MG307 homolog precu... | 28 | 8.2 | 2 | TRBG_RHISN (P55404) Probable conjugal transfer protein trbG prec... | 28 | 8.2 |
|---|
>Y436_MYCPN (P75342) Hypothetical lipoprotein MG307 homolog precursor| (A05_orf1244) Length = 1244 Score = 28.5 bits (62), Expect = 8.2 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = -3 Query: 295 PQSILG---HHGSSTFDK*KQSSSMDSGQEQVCNFFVQHDSRGQKNNIQNPSTLTLVSKQ 125 PQ + G ++ +S + + + ++D NFF + ++ IQ ++L LV KQ Sbjct: 971 PQGVFGSYFNYENSASEVKESTQTLDPN-----NFFYKTTTKPTVQAIQQVASLALVQKQ 1025 Query: 124 VLGQMTTNHF 95 + Q +T+H+ Sbjct: 1026 QMQQNSTDHY 1035
>TRBG_RHISN (P55404) Probable conjugal transfer protein trbG precursor| Length = 270 Score = 28.5 bits (62), Expect = 8.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 151 STLTLVSKQVLGQMTTNHFRGTTCL*SWKGTA 56 +TL S MTTN +GT+ W+GTA Sbjct: 14 ATLVFASAAEAQSMTTNEVKGTSISRKWRGTA 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,573,013 Number of Sequences: 219361 Number of extensions: 1244118 Number of successful extensions: 2459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2458 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)