| Clone Name | rbaal24i09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MAL1_APIME (Q17058) Alpha-glucosidase precursor (EC 3.2.1.20) (M... | 30 | 4.5 | 2 | IL5_SIGHI (Q9ESI9) Interleukin-5 precursor (IL-5) (T-cell replac... | 29 | 7.8 |
|---|
>MAL1_APIME (Q17058) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 567 Score = 30.0 bits (66), Expect = 4.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 496 NSFFGTAKEASSIHASPHMLVDNISLRTLNDIFKKFSASPQN 371 NSFF K+ +S+ SP+ N++ R LND FS ++ Sbjct: 457 NSFFNMFKKFASLKKSPYFKEANLNTRMLNDNVFAFSRETED 498
>IL5_SIGHI (Q9ESI9) Interleukin-5 precursor (IL-5) (T-cell replacing factor)| (TRF) (Eosinophil differentiation factor) Length = 132 Score = 29.3 bits (64), Expect = 7.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 465 HLSMLVPICLWTTLVSVP*MTSLKSFLQALKT 370 HLS+L C+WT V +P T +K L L T Sbjct: 6 HLSILTLACVWTFAVEIPMHTVVKETLIQLST 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,355,580 Number of Sequences: 219361 Number of extensions: 1445965 Number of successful extensions: 3136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3136 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)