| Clone Name | rbaal24i08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRI29_MOUSE (Q8R2Q0) Tripartite motif protein 29 | 30 | 2.8 | 2 | TRI29_HUMAN (Q14134) Tripartite motif protein 29 (Ataxia-telangi... | 29 | 6.2 | 3 | Y171_UREPA (Q9PQX2) Hypothetical protein UU171 | 28 | 8.1 |
|---|
>TRI29_MOUSE (Q8R2Q0) Tripartite motif protein 29| Length = 587 Score = 30.0 bits (66), Expect = 2.8 Identities = 26/98 (26%), Positives = 38/98 (38%), Gaps = 2/98 (2%) Frame = +2 Query: 47 HINSIYSIAGTFNKREQTRNSAARN*--MSPVDGNSKPQ*AH*LLVTSNGWQLSPMPGFQ 220 + N++Y G + R S +N M V GNS + L P Sbjct: 501 NFNNLYGTKGNYTSRVWEYTSTVQNSEDMPTVQGNSS-------------FSLKGFPSL- 546 Query: 221 LRHECHHGLHRVWRTIMRKCLSYTYEFYWGKLEGIGSN 334 LR + + W++ + LS+ FY K GIGSN Sbjct: 547 LRSQVPKAQPQTWKSGKQTLLSHYRPFYVNKGSGIGSN 584
>TRI29_HUMAN (Q14134) Tripartite motif protein 29 (Ataxia-telangiectasia group| D-associated protein) Length = 588 Score = 28.9 bits (63), Expect = 6.2 Identities = 23/96 (23%), Positives = 41/96 (42%) Frame = +2 Query: 47 HINSIYSIAGTFNKREQTRNSAARN*MSPVDGNSKPQ*AH*LLVTSNGWQLSPMPGFQLR 226 + N++Y G + R +S+ +N N P ++ S+ + L P +R Sbjct: 501 NFNNLYGTKGNYTSRVWEYSSSIQN-----SDNDLP-----VVQGSSSFSLKGYPSL-MR 549 Query: 227 HECHHGLHRVWRTIMRKCLSYTYEFYWGKLEGIGSN 334 + + W++ + LS+ FY K GIGSN Sbjct: 550 SQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSN 585
>Y171_UREPA (Q9PQX2) Hypothetical protein UU171| Length = 199 Score = 28.5 bits (62), Expect = 8.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 308 GKLEGIGSNINSRLRSFGLQTNKV 379 GKL G+ SNIN ++ F L N++ Sbjct: 66 GKLNGLASNINYKISKFTLNNNEI 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,187,949 Number of Sequences: 219361 Number of extensions: 1184440 Number of successful extensions: 2513 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2512 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)