| Clone Name | rbaal24i04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MMPLA_STRCO (Q53902) Putative membrane protein actII-3 | 32 | 1.3 | 2 | PHC3_MOUSE (Q8CHP6) Polyhomeotic-like protein 3 | 30 | 5.1 | 3 | V083_FOWPV (O72903) Protein FPV083 | 30 | 5.1 |
|---|
>MMPLA_STRCO (Q53902) Putative membrane protein actII-3| Length = 711 Score = 32.3 bits (72), Expect = 1.3 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 325 RHFSCGALEPSLVFARG-SEDSISAISRLPPACMEVSPISALTGFSPV 465 RHF G+ EP +V A+G S D + A P +EV+P G + V Sbjct: 414 RHFPAGSGEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGLAYV 461
>PHC3_MOUSE (Q8CHP6) Polyhomeotic-like protein 3| Length = 981 Score = 30.4 bits (67), Expect = 5.1 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%) Frame = -1 Query: 559 IYPRELQQPYHLIRAILQTEIGIMMQLMTYIEQERTL*VPK*EKLPCMQVA-TGRWQKSS 383 I+P+ L QP+ L+ + LQT + ++ L +P LP V G Q+S+ Sbjct: 411 IHPQALIQPHPLVSSALQTGPNLQQAAADQVQSTAQLNLPSHLPLPASPVVHIGPVQQSA 470 Query: 382 LLTPLQILMMVLRPRKRSA 326 L++P Q ++ ++ SA Sbjct: 471 LVSPGQQMVSPTSHQQYSA 489
>V083_FOWPV (O72903) Protein FPV083| Length = 421 Score = 30.4 bits (67), Expect = 5.1 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 5/58 (8%) Frame = +2 Query: 365 LQGGQKTRFLPSPGCHLHAWKFLLFRHSQGSLLFYVG-----HQLHHYPYFCLQNGSD 523 ++ + +RF+ C+LH WK ++ ++ + FY ++ +HY F + SD Sbjct: 224 IRDNRSSRFIMFGFCYLHHWKCAIYDKNRDFICFYDSGGNNPNEFNHYRNFFFYSNSD 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,936,802 Number of Sequences: 219361 Number of extensions: 1737177 Number of successful extensions: 3616 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3614 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)