| Clone Name | rbaal24f16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YDCR_ECOLI (P77730) Hypothetical protein ydcR | 30 | 1.2 | 2 | SYMM_XENLA (Q7T0Z0) Methionyl-tRNA synthetase, mitochondrial pre... | 30 | 2.0 | 3 | IF2_MYCLE (Q9Z5I9) Translation initiation factor IF-2 | 29 | 2.7 | 4 | PHF1_MOUSE (Q9Z1B8) PHD finger protein 1 (PHF1 protein) (T-compl... | 28 | 4.6 | 5 | YJDC_MOUSE (Q8K2D3) YjeF domain-containing protein 1 | 28 | 7.8 |
|---|
>YDCR_ECOLI (P77730) Hypothetical protein ydcR| Length = 468 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 133 ISRPVINNAFSICVVLHSIHIAPLR*FVEGVSLSNWGRFFLFST 2 + P+ S+ + H I IAP + F G NW RFF F+T Sbjct: 405 LPEPLDAGELSLAALTHHISIAPGKMFSTG---ENWSRFFRFNT 445
>SYMM_XENLA (Q7T0Z0) Methionyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.10) (Methionine--tRNA ligase 2) (Mitochondrial methionine--tRNA ligase) (MtMetRS) Length = 562 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -3 Query: 274 EPVRPAHSFRFCHHWCQRTTPHL--*RSRAQKAW 179 EPV PA + HHW + P L R R++ +W Sbjct: 217 EPVHPAPFLKLVHHWLEEELPDLSVSRQRSRLSW 250
>IF2_MYCLE (Q9Z5I9) Translation initiation factor IF-2| Length = 924 Score = 29.3 bits (64), Expect = 2.7 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 134 TTHAPTQASSSPSVIPSFLGTRPSQVWCSSLAPMMTEP 247 TT AP Q S +V+P G PS LAP +P Sbjct: 96 TTAAPVQVDHSAAVVPIVAGEGPSTAHREELAPPAGQP 133
>PHF1_MOUSE (Q9Z1B8) PHD finger protein 1 (PHF1 protein) (T-complex| testis-expressed 3) (Polycomblike 1) (mPCl1) Length = 559 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 125 PRNTTHAPTQASSS-PSVIPSFLGTRPSQVWCSSLAP 232 P+++ H+ T +SSS P++ P F P C SL+P Sbjct: 479 PKSSPHSVTASSSSVPALTPGFSRHSPPSPLCRSLSP 515
>YJDC_MOUSE (Q8K2D3) YjeF domain-containing protein 1| Length = 508 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +2 Query: 47 LHESSKG--GDMYRM*DNANGKGIVYYRPRNTTHAPTQASSSPSVIPSFLGTRPSQVWCS 220 LH++ G G Y+M + NG G V +P +++ AP V + P Q CS Sbjct: 79 LHQTELGPSGVGYQMSISQNGTGKVVKKPASSSSAPQSIPKRTDVKSQDVAISPQQQQCS 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,282,439 Number of Sequences: 219361 Number of extensions: 892845 Number of successful extensions: 2189 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2184 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)