| Clone Name | rbaal24d18 |
|---|---|
| Clone Library Name | barley_pub |
>ORYA_ORYSA (P25776) Oryzain alpha chain precursor (EC 3.4.22.-)| Length = 458 Score = 45.1 bits (105), Expect = 5e-05 Identities = 25/52 (48%), Positives = 27/52 (51%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSYXXXXXXXXXXXXXXXXXXXXXXSVCDSYNEC 2 RME NIKASSGKCGIAVEPSY +VCD+Y C Sbjct: 322 RMERNIKASSGKCGIAVEPSYPLKKGENPPNPGPTPPSPTPPPTVCDNYYTC 373
>RD21A_ARATH (P43297) Cysteine proteinase RD21a precursor (EC 3.4.22.-) (RD21)| Length = 462 Score = 37.7 bits (86), Expect = 0.009 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RM NI +SSGKCGIA+EPSY Sbjct: 330 RMARNIASSSGKCGIAIEPSY 350
>CPGP1_ZINOF (P82473) Cysteine proteinase GP-I (EC 3.4.22.-)| Length = 221 Score = 35.8 bits (81), Expect = 0.033 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 R+E NI SSGKCGIA+ PSY Sbjct: 194 RVERNIAESSGKCGIAISPSY 214
>CYSP4_BRANA (P25251) Cysteine proteinase COT44 precursor (EC 3.4.22.-)| (Fragment) Length = 328 Score = 35.0 bits (79), Expect = 0.056 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RME N+ + SGKCGIA+E SY Sbjct: 293 RMERNVASKSGKCGIAIEASY 313
>CYSPL_LYCES (P20721) Low-temperature-induced cysteine proteinase precursor (EC| 3.4.22.-) (Fragment) Length = 346 Score = 35.0 bits (79), Expect = 0.056 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSYXXXXXXXXXXXXXXXXXXXXXXSVCDSYNEC 2 R++ N+ +SSG CG+A+EPSY + CD Y++C Sbjct: 211 RVQRNVSSSSGLCGLAIEPSYPVKTGPNPPKPAPSPPSPVKPPTECDEYSQC 262
>GCP1_ARATH (Q94B08) Germination-specific cysteine protease 1 precursor (EC| 3.4.22.-) Length = 376 Score = 33.1 bits (74), Expect = 0.21 Identities = 17/22 (77%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -2 Query: 157 RMEXNIKAS-SGKCGIAVEPSY 95 RME N+ AS SGKCGIAVE SY Sbjct: 338 RMERNLAASKSGKCGIAVEASY 359
>CYSP1_ORYSA (Q7XR52) Cysteine protease 1 precursor (EC 3.4.22.-) (OsCP1)| Length = 490 Score = 31.2 bits (69), Expect = 0.81 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RME N+ A +GKCGIA+ SY Sbjct: 352 RMERNVTARTGKCGIAMMASY 372
>ORYB_ORYSA (P25777) Oryzain beta chain precursor (EC 3.4.22.-)| Length = 471 Score = 31.2 bits (69), Expect = 0.81 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RME NI ++GKCGIA+ SY Sbjct: 334 RMERNINVTTGKCGIAMMASY 354
>BROM2_ANACO (P14518) Bromelain, stem (EC 3.4.22.32)| Length = 212 Score = 29.3 bits (64), Expect = 3.1 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RM ++ +SSG CGIA++P Y Sbjct: 187 RMARDVSSSSGICGIAIDPLY 207
>CYSEP_PHAVU (P25803) Vignain precursor (EC 3.4.22.-) (Bean endopeptidase)| (Cysteine proteinase EP-C1) Length = 362 Score = 28.9 bits (63), Expect = 4.0 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RM+ NI G CGIA+ PSY Sbjct: 322 RMQRNISKKEGLCGIAMLPSY 342
>ERVB_TABDI (P60994) Ervatamin-B (EC 3.4.22.-) (ERV-B)| Length = 215 Score = 28.9 bits (63), Expect = 4.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 154 MEXNIKASSGKCGIAVEPSY 95 ME N+ +S+G CGIA PSY Sbjct: 192 MERNVASSAGLCGIAQLPSY 211
>CYSP_HEMSP (P43156) Thiol protease SEN102 precursor (EC 3.4.22.-)| Length = 360 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 RM+ I GKCGIA+E SY Sbjct: 323 RMQRGISDKRGKCGIAMEASY 343
>CPR1_ARATH (Q9LT77) Probable cysteine proteinase At3g19400 precursor (EC| 3.4.22.-) Length = 362 Score = 27.7 bits (60), Expect = 9.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 157 RMEXNIKASSGKCGIAVEPSY 95 +++ NI GKCGIA+ PSY Sbjct: 326 KLQRNIDDPFGKCGIAMMPSY 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,779,924 Number of Sequences: 219361 Number of extensions: 91323 Number of successful extensions: 152 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)