| Clone Name | rbaal23n12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LRTM3_MOUSE (Q8BZ81) Leucine-rich repeat transmembrane neuronal ... | 29 | 3.7 | 2 | IL2RB_RAT (P26896) Interleukin-2 receptor beta chain precursor (... | 28 | 6.2 | 3 | LRTM3_MACFA (Q9BGP6) Leucine-rich repeat transmembrane neuronal ... | 28 | 8.2 | 4 | LRTM3_HUMAN (Q86VH5) Leucine-rich repeat transmembrane neuronal ... | 28 | 8.2 |
|---|
>LRTM3_MOUSE (Q8BZ81) Leucine-rich repeat transmembrane neuronal protein 3| precursor Length = 582 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 138 CTFSNMGDESCNHPLRSVCTHGVDYLHITRYKCNIQHELL 19 CT+S G C PL + + Y T C + HELL Sbjct: 502 CTYSKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELL 541
>IL2RB_RAT (P26896) Interleukin-2 receptor beta chain precursor (IL-2| receptor) (P70-75) (High affinity IL-2 receptor beta subunit) (CD122 antigen) Length = 537 Score = 28.1 bits (61), Expect = 6.2 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = -1 Query: 144 KSCTFSNMGDESCNHP---LRSVCTHGVDYLHITRYKCNIQHEL 22 K+CTF HP LR + H + LHI +CNI E+ Sbjct: 121 KTCTF---------HPFDNLRLIAPHSLQVLHIETRRCNISWEV 155
>LRTM3_MACFA (Q9BGP6) Leucine-rich repeat transmembrane neuronal protein 3| precursor Length = 581 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -1 Query: 138 CTFSNMGDESCNHPLRSVCTHGVDYLHITRYKCNIQHELL 19 CT++ G C PL + + Y T C + HELL Sbjct: 501 CTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELL 540
>LRTM3_HUMAN (Q86VH5) Leucine-rich repeat transmembrane neuronal protein 3| precursor Length = 581 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -1 Query: 138 CTFSNMGDESCNHPLRSVCTHGVDYLHITRYKCNIQHELL 19 CT++ G C PL + + Y T C + HELL Sbjct: 501 CTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELL 540 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,029,176 Number of Sequences: 219361 Number of extensions: 680041 Number of successful extensions: 1464 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)