| Clone Name | rbaal23n08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester... | 73 | 3e-13 | 2 | CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester... | 70 | 2e-12 | 3 | CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester... | 64 | 1e-10 | 4 | CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester... | 64 | 1e-10 | 5 | CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester... | 32 | 0.64 |
|---|
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 127 VPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 20 VPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY Sbjct: 382 VPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 417
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 69.7 bits (169), Expect = 2e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 127 VPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 20 VPLIA LVSEI+AAYLMPPIESGSVDFAEFEPKLVY Sbjct: 370 VPLIAALVSEILAAYLMPPIESGSVDFAEFEPKLVY 405
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 63.9 bits (154), Expect = 1e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -2 Query: 127 VPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 20 +PLIA L SE++A YLMPPIESGSVDFAEFEP+LVY Sbjct: 370 IPLIAALASELLATYLMPPIESGSVDFAEFEPQLVY 405
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 63.9 bits (154), Expect = 1e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 127 VPLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 20 +PL+ L SEI+AAYLMPP+ESGSVDFAEFEP LVY Sbjct: 374 IPLVTSLASEILAAYLMPPVESGSVDFAEFEPNLVY 409
>CTH1_CHLRE (Q9AR22) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 2, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 2) (Copper target homolog 1 protein) Length = 407 Score = 31.6 bits (70), Expect = 0.64 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -2 Query: 124 PLIAQLVSEIIAAYLMPPIESGSVDFAEFEPKLVY 20 P++ ++V+E+ ++M P ESGS D + LVY Sbjct: 373 PILERMVAEVFQVFIMTPKESGSYDLDANKTALVY 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,505,302 Number of Sequences: 219361 Number of extensions: 157507 Number of successful extensions: 423 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 80,573,946 effective HSP length: 18 effective length of database: 76,625,448 effective search space used: 1839010752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)