| Clone Name | rbaal24b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHLA1_RAT (Q9QZA1) Pleckstrin homology-like domain family A memb... | 32 | 0.59 | 2 | PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A me... | 30 | 1.3 |
|---|
>PHLA1_RAT (Q9QZA1) Pleckstrin homology-like domain family A member 1| (Proline- and glutamine-rich protein) (PQR protein) Length = 263 Score = 31.6 bits (70), Expect = 0.59 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +1 Query: 13 PLLLPRNVPTAHGNNYDHPHGSKIPPQPSLR*HRHDIIITSSRLHRLCHRTS 168 P L P P AH + + HPH P P H H + + + HRL TS Sbjct: 214 PHLYPHPHPHAHSHPHPHPH-----PHPHQLQHAHQPLHSQPQGHRLLRSTS 260
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 25 PRNVPTAHGNNYDHPHGSKIP---PQPSLR*HRHDIIITSS 138 P + P +H + + HPH +IP PQP + H H ++ ++S Sbjct: 216 PHSHPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTS 256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,287,873 Number of Sequences: 219361 Number of extensions: 406209 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)