| Clone Name | rbaal24b07 |
|---|---|
| Clone Library Name | barley_pub |
>UCRIA_WHEAT (Q7X9A6) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 222 Score = 146 bits (369), Expect = 1e-35 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWNAA NKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG Sbjct: 157 VVPWNAAENKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 216 Query: 149 ENPWWK 132 +NPWWK Sbjct: 217 DNPWWK 222
>UCRIA_ORYSA (Q69S39) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 225 Score = 141 bits (356), Expect = 4e-34 Identities = 60/65 (92%), Positives = 64/65 (98%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWNAA NKF+CPCHGSQYNNQG+VVRGPAPLSLALVHADVDDGKV+FVPWVETDFRTG Sbjct: 160 VVPWNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALVHADVDDGKVLFVPWVETDFRTG 219 Query: 149 ENPWW 135 +NPWW Sbjct: 220 DNPWW 224
>UCRIA_SOLTU (Q69GY7) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 138 bits (348), Expect = 3e-33 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWN A NKF+CPCHGSQYNNQGKVVRGPAPLSLAL HAD+DDGKVVFVPWVETDFRTG Sbjct: 165 VVPWNTAENKFICPCHGSQYNNQGKVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTG 224 Query: 149 ENPWW 135 ++PWW Sbjct: 225 DSPWW 229
>UCRIA_TOBAC (P30361) Cytochrome b6-f complex iron-sulfur subunit 1, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 228 Score = 136 bits (342), Expect = 1e-32 Identities = 58/65 (89%), Positives = 63/65 (96%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVP+NAA NKF+CPCHGSQYNNQG+VVRGPAPLSLAL HAD+DDGKVVFVPWVETDFRTG Sbjct: 163 VVPFNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTG 222 Query: 149 ENPWW 135 E+PWW Sbjct: 223 EDPWW 227
>UCRIB_TOBAC (Q02585) Cytochrome b6-f complex iron-sulfur subunit 2, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 228 Score = 135 bits (339), Expect = 3e-32 Identities = 58/65 (89%), Positives = 62/65 (95%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVP+NAA NKF+CPCHGSQYNNQG+VVRGPAPLSLAL HAD+DDGKVVFVPWVETDFRTG Sbjct: 163 VVPFNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTG 222 Query: 149 ENPWW 135 E PWW Sbjct: 223 EAPWW 227
>UCRIA_SPIOL (P08980) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 132 bits (332), Expect = 2e-31 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVP+NAA NKF+CPCHGSQYNNQG+VVRGPAPLSLAL H DVDDGKVVFVPW ETDFRTG Sbjct: 164 VVPFNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHCDVDDGKVVFVPWTETDFRTG 223 Query: 149 ENPWW 135 E PWW Sbjct: 224 EAPWW 228
>UCRIA_FRIAG (O49078) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 132 bits (331), Expect = 3e-31 Identities = 58/66 (87%), Positives = 61/66 (92%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPWN A NKFLCPCHGSQYNNQGKVVRGPAPLSLAL H D+ ++GKVVFVPWVETDFRT Sbjct: 164 VVPWNKAENKFLCPCHGSQYNNQGKVVRGPAPLSLALSHCDISEEGKVVFVPWVETDFRT 223 Query: 152 GENPWW 135 GENPWW Sbjct: 224 GENPWW 229
>UCRIA_ARATH (Q9ZR03) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) (Proton gradient regulation protein 1) Length = 229 Score = 126 bits (316), Expect = 2e-29 Identities = 55/66 (83%), Positives = 60/66 (90%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDD-GKVVFVPWVETDFRT 153 VVPWN A NKFLCPCHGSQYN QG+VVRGPAPLSLAL HAD+D+ GKV+FVPWVETDFRT Sbjct: 163 VVPWNKAENKFLCPCHGSQYNAQGRVVRGPAPLSLALAHADIDEAGKVLFVPWVETDFRT 222 Query: 152 GENPWW 135 G+ PWW Sbjct: 223 GDAPWW 228
>UCRIA_PEA (P26291) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 230 Score = 122 bits (306), Expect = 2e-28 Identities = 54/67 (80%), Positives = 60/67 (89%), Gaps = 2/67 (2%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHAD--VDDGKVVFVPWVETDFR 156 VVP+N A NKF+CPCHGSQYN+QG+VVRGPAPLSLAL H D V+DGKVVFVPWVETDFR Sbjct: 163 VVPFNQAENKFICPCHGSQYNDQGRVVRGPAPLSLALAHCDVGVEDGKVVFVPWVETDFR 222 Query: 155 TGENPWW 135 TG+ PWW Sbjct: 223 TGDAPWW 229
>UCRI_MASLA (P83794) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 117 bits (292), Expect = 9e-27 Identities = 49/65 (75%), Positives = 52/65 (80%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWNAA NKF CPCHGSQY+ GKV+RGPAPLSLAL HA V D +V PW ETDFRTG Sbjct: 114 VVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTG 173 Query: 149 ENPWW 135 E PWW Sbjct: 174 EKPWW 178
>UCRI_SYNP6 (Q5N5B0) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 115 bits (287), Expect = 4e-26 Identities = 49/65 (75%), Positives = 52/65 (80%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWNA+ NKF CPCHGSQY+ GKVVRGPAPLSLAL H V D KV PW ETDFRTG Sbjct: 114 VVPWNASENKFKCPCHGSQYDATGKVVRGPAPLSLALAHVSVTDDKVFLSPWTETDFRTG 173 Query: 149 ENPWW 135 +NPWW Sbjct: 174 DNPWW 178
>UCRI_NOSSP (P14698) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 113 bits (282), Expect = 1e-25 Identities = 47/65 (72%), Positives = 52/65 (80%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWN A NKF CPCHGSQY+ GKVVRGPAPLSLAL HA+ D K++ PW ETDFRTG Sbjct: 114 VVPWNVAENKFKCPCHGSQYDETGKVVRGPAPLSLALAHANTVDDKIILSPWTETDFRTG 173 Query: 149 ENPWW 135 + PWW Sbjct: 174 DAPWW 178
>UCRIA_ANAVT (Q9L3P9) Cytochrome b6-f complex iron-sulfur subunit 1 (EC| 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 179 Score = 113 bits (282), Expect = 1e-25 Identities = 48/65 (73%), Positives = 52/65 (80%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWNAA NKF CPCHGSQY+ GKVVRGPAP SLAL HA ++ K+V PW ETDFRTG Sbjct: 114 VVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTPWTETDFRTG 173 Query: 149 ENPWW 135 E PWW Sbjct: 174 EEPWW 178
>UCRIB_SYNY3 (P26290) Cytochrome b6-f complex iron-sulfur subunit 2 (EC| 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 180 Score = 113 bits (282), Expect = 1e-25 Identities = 50/66 (75%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPWNA+ NKF+CPCHGSQYN +GKVVRGPAPLSLAL HA V DD K+V W ETDFRT Sbjct: 114 VVPWNASENKFMCPCHGSQYNAEGKVVRGPAPLSLALAHATVTDDDKLVLSTWTETDFRT 173 Query: 152 GENPWW 135 E+PWW Sbjct: 174 DEDPWW 179
>UCRI_PROMP (Q7V2L4) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 112 bits (281), Expect = 2e-25 Identities = 47/65 (72%), Positives = 52/65 (80%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPW++ NKF+CPCHGSQY+ GKVVRGPAPLSLAL H DVDD V+ W ETDFRT Sbjct: 113 VVPWDSGANKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDVDDDAVLVKQWSETDFRTN 172 Query: 149 ENPWW 135 ENPWW Sbjct: 173 ENPWW 177
>UCRI_PROMA (Q7VDC0) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 112 bits (279), Expect = 3e-25 Identities = 45/65 (69%), Positives = 52/65 (80%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWN+ NK++CPCHGSQY+ GKVVRGPAPLSLAL H D+DD V+ W ETDFRTG Sbjct: 113 VVPWNSGANKYICPCHGSQYDANGKVVRGPAPLSLALTHIDIDDDNVLVSQWTETDFRTG 172 Query: 149 ENPWW 135 + PWW Sbjct: 173 DKPWW 177
>UCRIA_CYAPA (Q5CC93) Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 239 Score = 112 bits (279), Expect = 3e-25 Identities = 49/67 (73%), Positives = 53/67 (79%), Gaps = 1/67 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPWNA+ NKF+CPCHGSQY+ GKVVRGPAPLSLAL H V +DG V F PW ETDFRT Sbjct: 173 VVPWNASENKFMCPCHGSQYDRTGKVVRGPAPLSLALAHVSVLEDGVVAFEPWTETDFRT 232 Query: 152 GENPWWK 132 PWWK Sbjct: 233 NTAPWWK 239
>UCRI_SYNP2 (P26292) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 180 Score = 112 bits (279), Expect = 3e-25 Identities = 49/66 (74%), Positives = 54/66 (81%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPWN A NKF+CPCHGSQY+ GKVVRGPAPLSLALVHA+V +D K+ F W ETDFRT Sbjct: 114 VVPWNTAENKFMCPCHGSQYDETGKVVRGPAPLSLALVHAEVTEDDKISFTDWTETDFRT 173 Query: 152 GENPWW 135 E PWW Sbjct: 174 DEAPWW 179
>UCRI_SYNEL (Q9X9T2) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 180 Score = 110 bits (276), Expect = 7e-25 Identities = 48/66 (72%), Positives = 55/66 (83%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPWN + NKF+CPCHGSQY++ GKVVRGPAPLSLALV A V +D K+VF PW E DFRT Sbjct: 114 VVPWNVSENKFICPCHGSQYDSTGKVVRGPAPLSLALVKATVTEDDKLVFTPWTEIDFRT 173 Query: 152 GENPWW 135 G+ PWW Sbjct: 174 GKEPWW 179
>UCRIA_ANASP (Q93SX0) Cytochrome b6-f complex iron-sulfur subunit 1 (EC| 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 179 Score = 110 bits (274), Expect = 1e-24 Identities = 47/65 (72%), Positives = 51/65 (78%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWNAA NKF CPCHGSQY+ GKVVRGPAP SLAL HA ++ K+V W ETDFRTG Sbjct: 114 VVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTG 173 Query: 149 ENPWW 135 E PWW Sbjct: 174 EEPWW 178
>UCRIA_VOLCA (Q9SBN3) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 206 Score = 109 bits (272), Expect = 2e-24 Identities = 50/66 (75%), Positives = 52/66 (78%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPW AA NKF CPCHGSQYN +GKVVRGPAPLSLAL H DV +DG V F W ETDFRT Sbjct: 140 VVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVQEDGLVTFSTWSETDFRT 199 Query: 152 GENPWW 135 G PWW Sbjct: 200 GLEPWW 205
>UCRIB_CYAPA (Q5CC92) Cytochrome b6-f complex iron-sulfur subunit 2, cyanelle| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 241 Score = 108 bits (269), Expect = 4e-24 Identities = 47/67 (70%), Positives = 52/67 (77%), Gaps = 1/67 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPWN + KF+CPCHGSQY+ GKVVRGPAPLSLAL H +V +DG V F PW ETDFRT Sbjct: 175 VVPWNQSEGKFMCPCHGSQYDRTGKVVRGPAPLSLALAHVNVLEDGVVAFEPWTETDFRT 234 Query: 152 GENPWWK 132 PWWK Sbjct: 235 NTAPWWK 241
>UCRIA_CHLRE (P49728) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 206 Score = 107 bits (268), Expect = 6e-24 Identities = 49/66 (74%), Positives = 51/66 (77%), Gaps = 1/66 (1%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADV-DDGKVVFVPWVETDFRT 153 VVPW AA NKF CPCHGSQYN +GKVVRGPAPLSLAL H DV + G V F W ETDFRT Sbjct: 140 VVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAESGLVTFSTWTETDFRT 199 Query: 152 GENPWW 135 G PWW Sbjct: 200 GLEPWW 205
>UCRI_PROMM (Q7V654) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 106 bits (265), Expect = 1e-23 Identities = 45/65 (69%), Positives = 51/65 (78%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWN+ NKF+CPCHGSQYN+ GKVVRGPAPLSLAL + V++ V W ETDFRTG Sbjct: 113 VVPWNSGVNKFVCPCHGSQYNSTGKVVRGPAPLSLALANIAVENDNVFVSQWTETDFRTG 172 Query: 149 ENPWW 135 E PWW Sbjct: 173 EKPWW 177
>UCRIA_CHLS6 (Q7XYM4) Cytochrome b6-f complex iron-sulfur subunit, chloroplast| precursor (EC 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 252 Score = 106 bits (264), Expect = 2e-23 Identities = 44/65 (67%), Positives = 49/65 (75%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPW+AA NKF CPCHGSQY G VVRGPAP L L H + D+GK++ PW ETDFRTG Sbjct: 187 VVPWDAASNKFKCPCHGSQYAPDGHVVRGPAPRPLQLAHVEDDNGKILLSPWTETDFRTG 246 Query: 149 ENPWW 135 E PWW Sbjct: 247 EKPWW 251
>UCRI_SYNPX (Q7U566) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 104 bits (259), Expect = 6e-23 Identities = 43/65 (66%), Positives = 50/65 (76%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTG 150 VVPWN+ NKF+CPCHGSQY+ GKVVRGPAPLSLAL + V++ V W ETDFRTG Sbjct: 113 VVPWNSGANKFMCPCHGSQYDATGKVVRGPAPLSLALANVSVENDNVFVSQWTETDFRTG 172 Query: 149 ENPWW 135 + PWW Sbjct: 173 DKPWW 177
>UCRIC_ANASP (P70758) Cytochrome b6-f complex iron-sulfur subunit 3 (EC| 1.10.99.1) (Rieske iron-sulfur protein 3) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 3) (ISP 3) (RISP 3) Length = 178 Score = 85.9 bits (211), Expect = 2e-17 Identities = 35/63 (55%), Positives = 41/63 (65%) Frame = -1 Query: 323 PWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTGEN 144 PWN +F CPCHGS+Y G VVRGPAPL L +V V D ++ PW ETD RTG+ Sbjct: 115 PWNPLDQQFQCPCHGSRYAPDGSVVRGPAPLPLKIVQVAVIDNSILISPWTETDPRTGKK 174 Query: 143 PWW 135 PWW Sbjct: 175 PWW 177
>UCRIA_SYNY3 (P74714) Cytochrome b6-f complex iron-sulfur subunit 1 (EC| 1.10.99.1) (Rieske iron-sulfur protein 1) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1) (ISP 1) (RISP 1) Length = 178 Score = 82.8 bits (203), Expect = 2e-16 Identities = 33/63 (52%), Positives = 40/63 (63%) Frame = -1 Query: 323 PWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTGEN 144 PWN +F CPCHGS+Y+ G V RGPAPL L +V V D ++ PW + D RTGE Sbjct: 115 PWNGNDQEFQCPCHGSRYHPDGSVARGPAPLPLKIVQVAVVDDQIFISPWTDLDPRTGEK 174 Query: 143 PWW 135 PWW Sbjct: 175 PWW 177
>UCRIB_ANAVT (Q93SW6) Cytochrome b6-f complex iron-sulfur subunit 2 (EC| 1.10.99.1) (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 178 Score = 81.6 bits (200), Expect = 4e-16 Identities = 35/63 (55%), Positives = 39/63 (61%) Frame = -1 Query: 323 PWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTGEN 144 PWN +F CPCHGS+Y+ QG V RGPA L LVH V D + W ETD RTGE Sbjct: 115 PWNPVDQQFQCPCHGSRYDAQGSVERGPANRPLKLVHVQVKDDYIWISSWQETDPRTGEK 174 Query: 143 PWW 135 PWW Sbjct: 175 PWW 177
>UCRIB_ANASP (Q93SW8) Cytochrome b6-f complex iron-sulfur subunit 2 (EC| 1.10.99.1) (Rieske iron-sulfur protein 2) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 2) (ISP 2) (RISP 2) Length = 178 Score = 81.6 bits (200), Expect = 4e-16 Identities = 35/63 (55%), Positives = 39/63 (61%) Frame = -1 Query: 323 PWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFRTGEN 144 PWN +F CPCHGS+Y+ QG V RGPA L LV V D + PW ETD RTGE Sbjct: 115 PWNPVDQQFQCPCHGSRYDAQGSVERGPANRPLKLVQVQVKDDYIWISPWQETDPRTGEK 174 Query: 143 PWW 135 PWW Sbjct: 175 PWW 177
>UCRI_GLOVI (Q7NCE1) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 186 Score = 78.6 bits (192), Expect = 4e-15 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 5/70 (7%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFVPWVETDFR-- 156 VVPW+ +F CPCHGS YN G + RGPAP LALV A V D KV+ PW E DFR Sbjct: 115 VVPWDNGAKQFKCPCHGSVYNADGGLERGPAPQPLALVKATVSDDKVLIAPWTEQDFRCT 174 Query: 155 ---TGENPWW 135 ++P+W Sbjct: 175 DLWCNKDPYW 184
>UCRI_CHLTE (Q9F722) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 180 Score = 54.7 bits (130), Expect = 6e-08 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVV 186 +V W+ A + CPCHG++Y GK++ GP PL L ++DGK+V Sbjct: 129 LVHWDEAADMIACPCHGAKYTQDGKIISGPQPLPLKQYKVKIEDGKIV 176
>UCRI_RICPR (Q9ZDQ5) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 177 Score = 47.4 bits (111), Expect = 9e-06 Identities = 18/29 (62%), Positives = 25/29 (86%) Frame = -1 Query: 305 NKFLCPCHGSQYNNQGKVVRGPAPLSLAL 219 N + CPCHGSQY++ G+V +GPAPL+LA+ Sbjct: 135 NGWFCPCHGSQYDSSGRVRKGPAPLNLAV 163
>UCRI_CHLLT (Q46136) Cytochrome b6-f complex iron-sulfur subunit (EC 1.10.99.1)| (Rieske iron-sulfur protein) (Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein) (ISP) (RISP) Length = 180 Score = 47.0 bits (110), Expect = 1e-05 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = -1 Query: 329 VVPWNAAXNKFLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVV 186 +V W A N++ CPCHG++Y G+++ GP PL L A ++ ++ Sbjct: 129 LVNWVDADNQYFCPCHGAKYKLTGEIISGPQPLPLKQYKARIEGDSII 176
>UCRI_SCHPO (Q09154) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 228 Score = 45.1 bits (105), Expect = 5e-05 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVV 186 + CPCHGS Y+ G++ RGPAPL+LA+ + K++ Sbjct: 189 WFCPCHGSHYDISGRIRRGPAPLNLAIPAYTFEGSKII 226
>UCRI_YEAST (P08067) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 215 Score = 44.7 bits (104), Expect = 6e-05 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVV 186 + CPCHGS Y+ G++ +GPAPL+L + + D KV+ Sbjct: 176 WFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVI 213
>UCRI_RAT (P20788) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) (Liver regeneration-related protein LRRGT00195) Length = 274 Score = 44.7 bits (104), Expect = 6e-05 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ +GPAPL+L + + G VV V Sbjct: 234 YYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVV 273
>UCRI_BRAJA (P51130) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 176 Score = 43.1 bits (100), Expect = 2e-04 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 F CPCHGSQY++ G++ +GPAP +L Sbjct: 136 FFCPCHGSQYDSSGRIRQGPAPANL 160
>UCRI_NEUCR (P07056) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 231 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/39 (43%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLAL-VHADVDDGKVV 186 + CPCHGS Y+ G++ +GPAPL+L + ++ ++GK+V Sbjct: 191 WFCPCHGSHYDISGRIRKGPAPLNLEIPLYEFPEEGKLV 229
>UCRI_RHORU (P23136) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 182 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/39 (46%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLAL-VHADVDDGKVV 186 + CPCHGS Y++ G++ +GPAPL+L + +A DD V+ Sbjct: 142 WFCPCHGSHYDSAGRIRKGPAPLNLPVPPYAFTDDTTVL 180
>UCRI_MOUSE (Q9CR68) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ +GPAPL+L + + VV V Sbjct: 234 YYCPCHGSHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVV 273
>UCRI_BOVIN (P13272) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)] Length = 274 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ +GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIV 273
>UCRI_RHOVI (P81380) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 179 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 1/38 (2%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLAL-VHADVDDGKV 189 + CPCHGSQY+ G+V +GPAP +L + + VD+ K+ Sbjct: 135 WFCPCHGSQYDASGRVRKGPAPTNLPVPPYEFVDNTKI 172
>UCRI_AOTAZ (Q69BJ9) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ +GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRKGPAPLNLEVPTYEFTSDDLVIV 273
>UCRI_PARDE (P05417) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 190 Score = 41.2 bits (95), Expect = 7e-04 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVV 186 + CPCHGS Y+ G++ RGPAP +L + A+ D + Sbjct: 150 WFCPCHGSHYDTSGRIRRGPAPQNLHIPVAEFLDDTTI 187
>UCRI_SAISC (Q69BJ7) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 40.8 bits (94), Expect = 8e-04 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAPL+L Sbjct: 234 YYCPCHGSHYDASGRIRKGPAPLNL 258
>UCRI_LAGLA (Q69BJ8) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 40.8 bits (94), Expect = 8e-04 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAPL+L Sbjct: 234 YYCPCHGSHYDASGRIRKGPAPLNL 258
>UCRI_CERAE (Q69BK1) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ GPAPL+L + + VV V Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNLEVPPYEFTGDDVVVV 273
>UCRI_RHOCA (P08500) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 191 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/35 (48%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLAL-VHADVDD 198 + CPCHGS Y++ G++ +GPAP +L + V A VD+ Sbjct: 151 WFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDE 185
>UCRI_PANTR (Q69BK5) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV 273
>UCRI_PANPA (Q69BK6) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV 273
>UCRI_HYLSY (Q69BJ6) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV 273
>UCRI_HUMAN (P47985) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV 273
>UCRI_GORGO (Q69BK4) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLALVHADVDDGKVVFV 180 + CPCHGS Y+ G++ GPAPL+L + + +V V Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV 273
>UCRI_PONPY (Q69BK3) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ GPAPL+L Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNL 258
>UCRI_COLPO (Q69BK0) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 39.3 bits (90), Expect = 0.002 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ GPAPL+L Sbjct: 234 YYCPCHGSHYDASGRIRLGPAPLNL 258
>UCRI_RHOSH (Q02762) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 187 Score = 38.9 bits (89), Expect = 0.003 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSLAL 219 + CPCHGS Y++ G++ +GPAP +L + Sbjct: 147 WFCPCHGSHYDSAGRIRKGPAPENLPI 173
>UCRI_THEGE (Q69BK2) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ GPAPL+L Sbjct: 234 YYCPCHGSHYDVSGRIRLGPAPLNL 258
>UCRI_MAIZE (P49727) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 273 Score = 38.5 bits (88), Expect = 0.004 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 233 WFCPCHGSHYDISGRIRKGPAPFNL 257
>UCRI2_TOBAC (P51132) Ubiquinol-cytochrome c reductase iron-sulfur subunit 2,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 2) (RISP2) Length = 272 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 232 WFCPCHGSHYDISGRIRKGPAPYNL 256
>UCRI5_TOBAC (P51135) Ubiquinol-cytochrome c reductase iron-sulfur subunit 5,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 5) (RISP5) Length = 268 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 228 WFCPCHGSHYDISGRIRKGPAPYNL 252
>UCRI3_TOBAC (P51133) Ubiquinol-cytochrome c reductase iron-sulfur subunit 3,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 3) (RISP3) Length = 268 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 228 WFCPCHGSHYDISGRIRKGPAPYNL 252
>UCRI1_TOBAC (P49729) Ubiquinol-cytochrome c reductase iron-sulfur subunit 1,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 1) (RISP1) (Fragment) Length = 258 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 218 WFCPCHGSHYDISGRIRKGPAPYNL 242
>UCRI_SOLTU (P37841) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 265 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 225 WFCPCHGSHYDISGRIRKGPAPYNL 249
>UCRI4_TOBAC (P51134) Ubiquinol-cytochrome c reductase iron-sulfur subunit 4,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 4) (RISP4) Length = 236 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRGPAPLSL 225 + CPCHGS Y+ G++ +GPAP +L Sbjct: 196 WFCPCHGSHYDISGRIRKGPAPYNL 220
>QCRA_CORDI (Q6NGA2) Probable menaquinol-cytochrome c reductase iron-sulfur| subunit (Rieske iron-sulfur protein) (Cytochrome bc1 complex Rieske iron-sulfur protein) Length = 406 Score = 36.6 bits (83), Expect = 0.016 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 320 WNAAXNKFLCPCHGSQYN--NQGKVVRGPAPLSLALVHADVDD 198 + A N+ LCPCH SQ++ + GK V GPA +L + VD+ Sbjct: 341 YEAQTNRILCPCHQSQFDALHYGKPVFGPAARALPQLPITVDE 383
>QCRA_CORGL (Q79VE8) Menaquinol-cytochrome c reductase iron-sulfur subunit| (Rieske iron-sulfur protein) (Cytochrome bc1 complex Rieske iron-sulfur protein) Length = 408 Score = 36.6 bits (83), Expect = 0.016 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 320 WNAAXNKFLCPCHGSQYN--NQGKVVRGPAPLSLALVHADVDD 198 + A N+ LCPCH SQ++ + GK V GPA +L + VD+ Sbjct: 343 YEAQTNRILCPCHQSQFDALHYGKPVFGPAARALPQLPITVDE 385
>QCRA_COREF (Q8FNR1) Probable menaquinol-cytochrome c reductase iron-sulfur| subunit (Rieske iron-sulfur protein) (Cytochrome bc1 complex Rieske iron-sulfur protein) Length = 408 Score = 36.6 bits (83), Expect = 0.016 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 320 WNAAXNKFLCPCHGSQYN--NQGKVVRGPAPLSLALVHADVDD 198 + A N+ LCPCH SQ++ + GK V GPA +L + VD+ Sbjct: 343 YEAQTNRILCPCHQSQFDALHYGKPVFGPAARALPQLPITVDE 385
>DYNA_NEUCR (Q01397) Dynactin, 150 kDa isoform (150 kDa dynein-associated| polypeptide) (DP-150) (DAP-150) (p150-glued) Length = 1300 Score = 35.8 bits (81), Expect = 0.027 Identities = 28/75 (37%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = -2 Query: 319 GTPPRTSSSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTAR--SSSCHGWRPTSGPAR 146 GTP T+ A P+T TR LS H P TPT+ T R S S G RP+ G R Sbjct: 98 GTPSTTTKPA---GPTTRTRPSLSTSRH-SMGPPPTPTTRTTRKPSVSSVGTRPSIGATR 153 Query: 145 TRGGNKRHKLRQQSS 101 GG R ++ Sbjct: 154 PVGGRASMSARSSTN 168
>QCRA_BACSU (P46911) Menaquinol-cytochrome c reductase iron-sulfur subunit| (Rieske iron-sulfur protein) Length = 167 Score = 33.9 bits (76), Expect = 0.10 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -1 Query: 326 VPWNAAX---NKFLCPCHGSQYNNQGKVVRGPAPLS-LALVHADVDDG 195 V WN+ NKF CPCH Y G V G PL+ L +V DG Sbjct: 107 VNWNSDPKNPNKFFCPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDG 154
>VE2_HPV25 (P36787) Regulatory protein E2| Length = 502 Score = 33.1 bits (74), Expect = 0.18 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = -2 Query: 277 PSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRPTSGPARTRGGNKRHKLRQ 110 P+TTT R + R PS T ++T+ RS +S R RGG +RH+L + Sbjct: 321 PTTTTSDRAA------RSPSTTSSATSQRSQRSRSRAGSSRGGRGRGGRRRHRLSE 370
>QCRA_BACTC (Q45657) Menaquinol-cytochrome c reductase iron-sulfur subunit| (Rieske iron-sulfur protein) Length = 169 Score = 32.7 bits (73), Expect = 0.23 Identities = 19/50 (38%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = -1 Query: 326 VPWNAAXNK---FLCPCHGSQYNNQGKVVRGPAPLS-LALVHADVDDGKV 189 V WN N F CPCH Y G V G P + L +V DGK+ Sbjct: 109 VDWNTDKNNPNHFFCPCHYGLYTKDGTNVPGTPPTAPLDRYEFEVKDGKL 158
>QCRA_MYCTU (Q10387) Ubiquinol-cytochrome c reductase iron-sulfur subunit| (Rieske iron-sulfur protein) Length = 429 Score = 30.8 bits (68), Expect = 0.88 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -1 Query: 302 KFLCPCHGSQYN--NQGKVVRGPAPLSLALVHADVD-DGKVV 186 + LCPCH SQ++ + K + GPA +LA + +D DG +V Sbjct: 369 RILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLV 410
>QCRA_MYCBO (Q7TYX4) Ubiquinol-cytochrome c reductase iron-sulfur subunit| (Rieske iron-sulfur protein) Length = 429 Score = 30.8 bits (68), Expect = 0.88 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -1 Query: 302 KFLCPCHGSQYN--NQGKVVRGPAPLSLALVHADVD-DGKVV 186 + LCPCH SQ++ + K + GPA +LA + +D DG +V Sbjct: 369 RILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLV 410
>ASP_DROME (Q9VC45) Protein abnormal spindle| Length = 1954 Score = 30.4 bits (67), Expect = 1.1 Identities = 19/52 (36%), Positives = 26/52 (50%) Frame = -2 Query: 220 SFTPTSTTARSSSCHGWRPTSGPARTRGGNKRHKLRQQSSLV*YVKPPASPK 65 S P + +ARSSS H W +K+ KL Q SL +K PA+P+ Sbjct: 529 SAAPANASARSSSAHAW--------PHAQSKKFKLAQTMSL---MKKPATPR 569
>UCRI_CHRVI (O31214) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 207 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -1 Query: 299 FLCPCHGSQYNNQGKVVRG-PAPLSLAL 219 F CPCHGS+++ +V + PAP +L + Sbjct: 160 FHCPCHGSRFDLAARVFKNVPAPTNLVI 187
>CRTB_RHOS4 (P54905) Phytoene synthase (EC 2.5.1.-)| Length = 355 Score = 30.0 bits (66), Expect = 1.5 Identities = 23/67 (34%), Positives = 33/67 (49%) Frame = +3 Query: 126 RLFPPRVLAGPEVGLHPWHEDDLAVVDVGVNEGQRQRCRSTDNLALVVVLGSMARAEELV 305 RL P RV A P + L+ + VD VN+GQR+ A++ S+ +LV Sbjct: 26 RLLPERVRA-PSLALYAFCRVADDAVDEAVNDGQREEDAEVKRRAVL----SLRDRLDLV 80 Query: 306 LGGVPRH 326 GG PR+ Sbjct: 81 YGGRPRN 87
>TRIB1_HUMAN (Q96RU8) Tribbles homolog 1 (TRB-1) (SKIP1) (G-protein-coupled| receptor induced protein 2) (GIG-2) Length = 372 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 114 RSLCRLFPPRVLAGPEVGLHPWHEDDL 194 RSL R P L PE+ LHPW E L Sbjct: 316 RSLLRREPSERLTAPEILLHPWFESVL 342
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 29.6 bits (65), Expect = 2.0 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 316 TPPRTSSSA--LAMDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRPTSGPART 143 T P T+S L+ PSTTT + S PT +T ++++ W PT P T Sbjct: 4257 TAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLST 4316
>ARSS_CENAS (Q8GGJ7) Arsenite oxidase small subunit precursor (EC 1.20.98.1)| Length = 173 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 326 VPWNAAXNKFLCPCHGSQY--NNQGKVVRGPAPLSL 225 V ++A+ F CPCH S + +N G++V G A +L Sbjct: 107 VSYDASAKTFKCPCHFSVFDPDNHGQMVCGQATENL 142
>TRIB1_MOUSE (Q8K4K4) Tribbles homolog 1 (TRB-1)| Length = 372 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 114 RSLCRLFPPRVLAGPEVGLHPWHE 185 RSL R P L P++ LHPW E Sbjct: 316 RSLLRREPSERLTAPQILLHPWFE 339
>SDHD_VIBPA (Q87QA2) Probable D-serine dehydratase (EC 4.3.1.18) (D-serine| deaminase) (DSD) Length = 443 Score = 28.1 bits (61), Expect = 5.7 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +3 Query: 138 PRVLAGPEVGLHPWHEDDLAVVDVGVNEGQRQRCRSTDNLALVVVLGSMARAEELVLGG 314 P +L G GLH D++AV D+G++ + D LA+ G + RA E ++ G Sbjct: 310 PCMLLGVHTGLH----DEIAVQDIGID-----NLTAADGLAVGRPSGFVGRAMERLIDG 359
>WSC2_YEAST (P53832) Cell wall integrity and stress response component 2| precursor Length = 503 Score = 28.1 bits (61), Expect = 5.7 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = -2 Query: 316 TPPRTSSSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRPTSGPARTRG 137 T +S+++ + PSTT+ + + T +STT+ SSS TS P+ T Sbjct: 199 TSTTSSTTSTSSSPSTTSSSTSASSSSETSSTQATSSSTTSTSSSTSTATVTSTPSSTSI 258 Query: 136 GNKRH 122 G H Sbjct: 259 GTSTH 263
>VE1_PCPV1 (Q02262) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 648 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 227 ATEVQVHGQPCPGCCTGIHGKGR 295 AT+V+ HG+P GC G HG+ + Sbjct: 147 ATQVERHGEPENGCGGGGHGRDK 169
>ESC_DROVI (Q26458) Polycomb protein esc (Protein extra sex combs)| Length = 425 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 220 SFTPTSTTARSSSCHGWRPTSGPARTRGGNKRHKLRQQS 104 SFT STT+RS S P S R G + HK + +S Sbjct: 25 SFTTNSTTSRSKS-----PASSTRSKRRGRRSHKSKPKS 58
>SLIK1_MOUSE (Q810C1) SLIT and NTRK-like protein 1 precursor| Length = 696 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 242 VHGQPCPGCCTGIHGKGRG 298 VHG PCPG C+ H G G Sbjct: 336 VHGLPCPGGCSCDHIPGSG 354
>OMB_DROME (Q24432) Optomotor-blind protein (Lethal(1)optomotor-blind)| (L(1)omb) (Protein bifid) Length = 972 Score = 27.7 bits (60), Expect = 7.4 Identities = 25/103 (24%), Positives = 38/103 (36%) Frame = -2 Query: 313 PPRTSSSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRPTSGPARTRGG 134 PP +SS+ + + S + A PS PT+ S S P +GP Sbjct: 174 PPNNNSSSSSSNNSASAAAH----------PSHHPTAAH-HSPSTGAAAPPAGPTGLPPP 222 Query: 133 NKRHKLRQQSSLV*YVKPPASPKNAAIRVLPAINAPVYLYPXI 5 H L+QQ + PP P A + +P +P + Sbjct: 223 TPPHHLQQQQQQQQHPAPPPPPYFPAAALAALAGSPAGPHPGL 265
>CUT_DROME (P10180) Homeobox protein cut| Length = 2175 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -2 Query: 313 PPRTSSSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGW 170 PP +SS++ STT+ + S S TP TTA +++ GW Sbjct: 2132 PPPAASSSIVSGESTTSSSSSS------NTSSSTPAVTTAAATAAAGW 2173
>MMPL3_MYCTU (O53657) Putative membrane protein mmpL3| Length = 944 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 304 TSSSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTA 194 T SAL + + + VD H +W +FTPT TA Sbjct: 588 TLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTA 624
>DHE2_YEAST (P33327) NAD-specific glutamate dehydrogenase (EC 1.4.1.2)| (NAD-GDH) Length = 1092 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -1 Query: 203 DDGKVVFVPWVETDFRTGENPWWK 132 D+G FV W R PWWK Sbjct: 680 DEGTAGFVDWATNHARVRNCPWWK 703
>DAN4_YEAST (P47179) Cell wall protein DAN4 precursor| Length = 1161 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = -2 Query: 328 SCLGTPPRTSSSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRPTSGPA 149 S T P TS++ STT++ S TPT++T ++S PT+ Sbjct: 219 STTSTTPTTSTTPTTSTTSTTSQTSTKSTTPTTSSTSTTPTTSTTPTTSTTSTAPTTSTT 278 Query: 148 RT 143 T Sbjct: 279 ST 280
>Y1283_THEMA (Q9X109) UPF0078 membrane protein TM1283| Length = 203 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 73 WQEA*HITRVSFAAGACVAYFHHGFSPVLK 162 W E+ H+ R A A H FSP LK Sbjct: 72 WNESFHVNRYVIAFAALSGILGHAFSPFLK 101
>EDG5_RAT (P47752) Sphingosine 1-phosphate receptor Edg-5 (S1P receptor| Edg-5) (G-protein coupled receptor H218) (AGR16) (Endothelial differentiation G-protein coupled receptor 5) (Sphingosine 1-phosphate receptor 2) (S1P2) Length = 352 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -2 Query: 172 WRPTSGPARTRGGNKRHK---LRQQSSLV*YVKPPASP 68 WR G RGGN H+ LR SSL + P SP Sbjct: 306 WRQGKGATGRRGGNPGHRLLPLRSSSSLERGLHMPTSP 343
>CBL_HUMAN (P22681) E3 ubiquitin-protein ligase CBL (EC 6.3.2.-) (Signal| transduction protein CBL) (Proto-oncogene c-CBL) (Casitas B-lineage lymphoma proto-oncogene) (RING finger protein 55) Length = 906 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 300 VPLPLPWIPVQQPGQGCPWT 241 +P P+P +PV P PWT Sbjct: 591 LPRPIPKVPVSAPSSSDPWT 610
>ILVE_RICPR (O05970) Probable branched-chain-amino-acid aminotransferase (EC| 2.6.1.42) (BCAT) Length = 290 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 316 TPPRTSSSALAMDPSTTTRA-RLSVDLHLCRWPSFTPTSTTARSSS 182 T P S++ L S+ R+ SV LH+ RW P ST +S S Sbjct: 111 TNPDLSTNFLIASISSMPRSCEQSVHLHVSRWRKAMPNSTPVQSKS 156
>VE2_HPV5B (P26545) Regulatory protein E2| Length = 514 Score = 27.3 bits (59), Expect = 9.7 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 4/68 (5%) Frame = -2 Query: 298 SSALAMDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRPTSGPAR----TRGGN 131 S + PST R R PS + TT RS PT+ AR +RGG+ Sbjct: 310 SRSRGRSPSTCRRGGGRSPRRRSRSPSTYSSCTTQRSQRARAESPTTRGARGSRGSRGGS 369 Query: 130 KRHKLRQQ 107 + +LR++ Sbjct: 370 RGGRLRRR 377
>DZIP3_HUMAN (Q86Y13) Ubiquitin ligase protein DZIP3 (EC 6.3.2.-) (DAZ-interacting| protein 3) (RNA-binding ubiquitin ligase of 138 kDa) (hRUL138) Length = 1208 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/79 (24%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = -2 Query: 283 MDPSTTTRARLSVDLHLCRWPSFTPTSTTARSSSCHGWRP--TSGPARTRGGNKRHKLRQ 110 +DP + SV C PS +P+ A WRP + GPA G + + + Sbjct: 1084 IDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPAWRPLTSQGPATWEGASNPDEEEE 1143 Query: 109 QSSLV*YVKPPASPKNAAI 53 + SP+N ++ Sbjct: 1144 EEEPCVICHENLSPENLSV 1162
>THIE_SYNY3 (P72965) Probable thiamine-phosphate pyrophosphorylase (EC 2.5.1.3)| (TMP pyrophosphorylase) (TMP-PPase) (Thiamine-phosphate synthase) Length = 343 Score = 27.3 bits (59), Expect = 9.7 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = +3 Query: 168 LHPWHEDDLAVV-----DVGVNEGQRQRCRSTDNLALVVVLGSMARAEE 299 L PWH+DDL DVG Q TD AL + ++ R EE Sbjct: 51 LAPWHQDDLRAARDTPNDVGTQLTHAQEALRTDVRAL--LQANLCRVEE 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,726,419 Number of Sequences: 219361 Number of extensions: 861762 Number of successful extensions: 3423 Number of sequences better than 10.0: 98 Number of HSP's better than 10.0 without gapping: 3273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3411 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)