| Clone Name | rbaal24b05 |
|---|---|
| Clone Library Name | barley_pub |
>TRME_STRP8 (Q8P161) tRNA modification GTPase trmE| Length = 458 Score = 34.7 bits (78), Expect = 0.26 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLIN-QLPSKGFKLTNKAD 275 +TDDLV ++G RSK+ +Q+A ++ +V+ + L+N S L NK D Sbjct: 284 ETDDLVEQIGVERSKKALQEADLVLLVLNASEKLTDQDRALLNLSQDSNRIILLNKTD 341
>TRME_STRP3 (Q8K7L5) tRNA modification GTPase trmE| Length = 458 Score = 34.7 bits (78), Expect = 0.26 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLIN-QLPSKGFKLTNKAD 275 +TDDLV ++G RSK+ +Q+A ++ +V+ + L+N S L NK D Sbjct: 284 ETDDLVEQIGVERSKKALQEADLVLLVLNASEKLTDQDRALLNLSQDSNRIILLNKTD 341
>TRME_STRP1 (Q99ZU0) tRNA modification GTPase trmE| Length = 458 Score = 34.7 bits (78), Expect = 0.26 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLIN-QLPSKGFKLTNKAD 275 +TDDLV ++G RSK+ +Q+A ++ +V+ + L+N S L NK D Sbjct: 284 ETDDLVEQIGVERSKKALQEADLVLLVLNASEKLTDQDRALLNLSQDSNRIILLNKTD 341
>TRME_STRMU (Q8DTT8) tRNA modification GTPase trmE| Length = 455 Score = 34.3 bits (77), Expect = 0.34 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVV-PGKSVACQLETLLINQLPSKGFKLTNKAD 275 +TDDLV ++G RSK+ +++A ++ +V+ + + Q TLL S L NK D Sbjct: 281 ETDDLVEKIGVERSKKALEEADLVLLVLNSAEKLTDQDRTLLEISQNSNRLILLNKTD 338
>TRME_STRP6 (Q5XCB7) tRNA modification GTPase trmE| Length = 458 Score = 33.5 bits (75), Expect = 0.58 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLIN-QLPSKGFKLTNKAD 275 +TDDLV ++G RSK+ +Q++ ++ +V+ + L+N S L NK D Sbjct: 284 ETDDLVEQIGVERSKKALQESDLVLLVLNASEKLTDQDRALLNLSQDSNRIILLNKTD 341
>TRME_CLOAB (Q97CW2) tRNA modification GTPase trmE| Length = 459 Score = 33.5 bits (75), Expect = 0.58 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLPSKGF-KLTNKADGK 269 +T+D++ ++G RSKE M++A ++ ++ + +I+ + K + L NK D K Sbjct: 283 ETEDVIEKMGVERSKEKMENADLIIFMIDSSKKIDAEDLEIIDYIKDKKYIVLLNKVDLK 342 Query: 268 HR 263 +R Sbjct: 343 NR 344
>TRME_BACAN (Q81JD9) tRNA modification GTPase trmE| Length = 458 Score = 33.1 bits (74), Expect = 0.76 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLPSKGF-KLTNKAD 275 +T+D+V R+G RSKE M A ++ +VV + L + K F + NK D Sbjct: 280 ETEDVVERIGVERSKEMMSQADLVLVVVNYSETLTNEDEELFRAVQGKDFIVIVNKTD 337
>TRME_BACCR (Q814F6) tRNA modification GTPase trmE| Length = 458 Score = 32.7 bits (73), Expect = 1.00 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLPSKGF-KLTNKAD 275 +T+D+V R+G RSKE M A ++ +VV + L + K F + NK D Sbjct: 280 ETEDVVERIGVERSKEMMSQADLVLVVVNYSEALTNEDEDLFRAVQGKDFIVIVNKTD 337
>TRME_STRA5 (Q8CX13) tRNA modification GTPase trmE| Length = 458 Score = 32.3 bits (72), Expect = 1.3 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 442 TDDLVGRLGAHRSKEGMQDATILYIVV-PGKSVACQLETLLINQLPSKGFKLTNKAD 275 TDD+V ++G RSK+ +++A ++ +V+ + + Q +LL S L NK D Sbjct: 285 TDDIVEKIGVERSKKALEEADLVLLVLNSSEPLTLQDRSLLELSKESNRIVLLNKTD 341
>TRME_STRA3 (Q8E5T7) tRNA modification GTPase trmE| Length = 458 Score = 32.3 bits (72), Expect = 1.3 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 442 TDDLVGRLGAHRSKEGMQDATILYIVV-PGKSVACQLETLLINQLPSKGFKLTNKAD 275 TDD+V ++G RSK+ +++A ++ +V+ + + Q +LL S L NK D Sbjct: 285 TDDIVEKIGVERSKKALEEADLVLLVLNSSEPLTLQDRSLLELSKESNRIVLLNKTD 341
>TRME_NEIMB (Q9JXL4) Probable tRNA modification GTPase trmE| Length = 448 Score = 32.3 bits (72), Expect = 1.3 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 2/86 (2%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLPS--KG 299 H + T +TDD+V R+G RS++ + +A + ++V + + +++ LP K Sbjct: 267 HIVDTAGLRETDDVVERIGIERSRKAVSEADVALVLVDPREGLNEKTRAILDALPPELKR 326 Query: 298 FKLTNKADGKHRNFGMSVTSGEAMAA 221 ++ +K+D G T E + A Sbjct: 327 IEIHSKSDLHAHAAGGFGTGAETVIA 352
>TRME_STRAG (Q9RL97) Probable tRNA modification GTPase trmE| Length = 462 Score = 32.3 bits (72), Expect = 1.3 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 442 TDDLVGRLGAHRSKEGMQDATILYIVV-PGKSVACQLETLLINQLPSKGFKLTNKAD 275 TDD+V ++G RSK+ +++A ++ +V+ + + Q +LL S L NK D Sbjct: 289 TDDIVEKIGVERSKKALEEADLVLLVLNSSEPLTLQDRSLLELSKESNRIVLLNKTD 345
>TRME_NEIMA (Q9JWB7) Probable tRNA modification GTPase trmE| Length = 448 Score = 32.0 bits (71), Expect = 1.7 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 2/86 (2%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLP--SKG 299 H + T +TDD+V R+G RS++ + +A + ++V + + +++ LP K Sbjct: 267 HIVDTAGLRETDDVVERIGIERSRKAVSEADVALVLVDPREGLNEKTRAILDALPLELKR 326 Query: 298 FKLTNKADGKHRNFGMSVTSGEAMAA 221 ++ +K+D G T E + A Sbjct: 327 IEIHSKSDLHAHAAGGFGTGAETVIA 352
>TRME_CLOTE (Q899S2) tRNA modification GTPase trmE| Length = 459 Score = 32.0 bits (71), Expect = 1.7 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLPSKGF-KLTNKAD 275 +T+DLV ++G RSKE + +A ++ +V+ + + +I + K + L NK+D Sbjct: 283 ETEDLVEKIGVERSKEKINEADLVILVLDSSNKLNDEDYEIIEYIKDKKYITLLNKSD 340
>TRPV5_RAT (Q9JIP0) Transient receptor potential cation channel subfamily V| member 5 (TrpV5) (osm-9-like TRP channel 3) (OTRPC3) (Epithelial calcium channel 1) (ECaC1) (Calcium transporter 2) (CaT2) Length = 723 Score = 31.6 bits (70), Expect = 2.2 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 20/109 (18%) Frame = -2 Query: 583 VGRSSIYIIIRRDNKLYV---------------GQVFAQSSIHVFFCSFV*GHEILTPPC 449 VG+++++I I N V G F +SS ++ + H + C Sbjct: 110 VGQTALHIAIMNQNVNLVRALLARGASASARATGSAFHRSSHNLIYYG---EHPLSFAAC 166 Query: 448 LQTDDLVGRLGAHRSKEGMQDA---TILYIVV--PGKSVACQLETLLIN 317 + ++++V L H + QD+ T+L+I+V P K+ ACQ+ LL++ Sbjct: 167 VGSEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLS 215
>TRPV5_MOUSE (P69744) Transient receptor potential cation channel subfamily V| member 5 (TrpV5) (osm-9-like TRP channel 3) (OTRPC3) (Epithelial calcium channel 1) (ECaC1) (Calcium transport protein 2) (CaT2) Length = 723 Score = 31.2 bits (69), Expect = 2.9 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 5/76 (6%) Frame = -2 Query: 529 GQVFAQSSIHVFFCSFV*GHEILTPPCLQTDDLVGRLGAHRSKEGMQDA---TILYIVV- 362 G F +SS ++ + H + C+ ++++V L H + QD+ T+L+I+V Sbjct: 143 GSAFHRSSHNLIYYG---EHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILVL 199 Query: 361 -PGKSVACQLETLLIN 317 P K+ ACQ+ LL++ Sbjct: 200 QPNKTFACQMYNLLLS 215
>ACKA_BORBU (O51567) Acetate kinase (EC 2.7.2.1) (Acetokinase)| Length = 405 Score = 31.2 bits (69), Expect = 2.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +3 Query: 6 FTLVIPYTW*KNYPYYEHSWAILPIRQNWGGHGISYSCLLKDKKQIRKSKV 158 F IPY+W KN+ + +G HG+SYS + K +I K+ Sbjct: 161 FLYAIPYSWYKNHNI-----------RKYGFHGLSYSYITKRSSEILNKKI 200
>TRME_AQUAE (O67030) Probable tRNA modification GTPase trmE| Length = 448 Score = 30.8 bits (68), Expect = 3.8 Identities = 22/107 (20%), Positives = 49/107 (45%), Gaps = 4/107 (3%) Frame = -2 Query: 583 VGRSSIYIIIRRDNKLYVGQVFAQSSIHVFFCSFV*GHEIL---TPPCLQTDDLVGRLGA 413 VG+SS++ + ++ + V + + + + G + T +T DLV R+G Sbjct: 226 VGKSSLFNALLKEERAIVTDIAGTTRDFIEETLQIKGVPVRLVDTAGIRETKDLVERIGV 285 Query: 412 HRSKEGMQDATILYIVVPGKSVACQLETLLINQLPSKG-FKLTNKAD 275 RSK+ +++A ++ V+ + + + ++ K + NK D Sbjct: 286 ERSKQKVKEADLILFVIDASQEITEEDLRIYEEIKEKDHIVVANKVD 332
>SPIN_CBEPV (P23061) Spindolin precursor (Spheroidin) (p50)| Length = 341 Score = 30.8 bits (68), Expect = 3.8 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 8/68 (11%) Frame = +3 Query: 177 ASTS*NWMFSGAVQCAAMASPEVTDI--------PKFRCLPSALLVSLKPFEGS*FMRRV 332 AS + N+M++ + AA+A P+ T+I P + C A S++PF M Sbjct: 76 ASEAANYMYTQDNEYAALAGPDYTNICHIQQRVVPSYLCAAGASDWSIRPFGDKSGMDLP 135 Query: 333 SSWHATLL 356 SW T++ Sbjct: 136 GSWTPTII 143
>TRME_BACHD (Q9RCA7) Probable tRNA modification GTPase trmE| Length = 458 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVP-GKSVACQLETLLINQLPSKGFKLTNKAD 275 +T+D+V R+G RS+E +++A ++ +V+ G+ ++ + E L + + NK D Sbjct: 280 ETEDIVERIGVERSREVLKEAELILLVLNFGEELSKEDEALFEAISGMEAIVIVNKTD 337
>TRPV6_HUMAN (Q9H1D0) Transient receptor potential cation channel subfamily V| member 6 (TrpV6) (Epithelial calcium channel 2) (ECaC2) (Calcium transport protein 1) (CaT1) (CaT-like) (CaT-L) Length = 725 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDA---TILYIVV--PGKSVACQLETLLIN 317 H + C+ ++++V L H + QD+ T+L+I++ P K+ ACQ+ LL++ Sbjct: 165 HPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS 221
>TRME_STRR6 (Q8DPZ8) tRNA modification GTPase trmE| Length = 457 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVV-PGKSVACQLETLLINQLPSKGFKLTNKAD 275 +TDD+V ++G RSK+ +++A ++ +V+ + + Q LL + L NK D Sbjct: 283 ETDDIVEQIGVERSKKALKEADLVLLVLNASEPLTAQDRQLLEISQDTNRIILLNKTD 340
>TRME_STRPN (Q97R24) tRNA modification GTPase trmE| Length = 457 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVV-PGKSVACQLETLLINQLPSKGFKLTNKAD 275 +TDD+V ++G RSK+ +++A ++ +V+ + + Q LL + L NK D Sbjct: 283 ETDDIVEQIGVERSKKALKEADLVLLVLNASEPLTAQDRQLLEISQETNRIILLNKTD 340
>TRPV5_HUMAN (Q9NQA5) Transient receptor potential cation channel subfamily V| member 5 (TrpV5) (osm-9-like TRP channel 3) (OTRPC3) (Epithelial calcium channel 1) (ECaC) (ECaC1) (Calcium transport protein 2) (CaT2) Length = 729 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDA---TILYIVV--PGKSVACQLETLLIN 317 H + C+ ++++V L H + QD+ T+L+I++ P K+ ACQ+ LL++ Sbjct: 165 HPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS 221
>ZN619_HUMAN (Q8N2I2) Zinc finger protein 619| Length = 560 Score = 30.0 bits (66), Expect = 6.5 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -1 Query: 383 HNTIHRGSWQERCVPTGDSSHKSATLERF*AHQQGRWQASELWYVCN-LWRSHGCA 219 H IH G C G + H+S+ F HQ R+ E Y CN W++ C+ Sbjct: 346 HQRIHTGEKPYECKECGKAFHRSSV---FLQHQ--RFHTGEQLYKCNECWKTFSCS 396
>TRME_ENTFA (Q820T0) tRNA modification GTPase trmE| Length = 465 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = -2 Query: 445 QTDDLVGRLGAHRSKEGMQDATILYIVVPGKSVACQLETLLINQLPSKGFK---LTNKAD 275 +T+D+V R+G RS++ + D+ ++ +V+ + + L+ +KG K L NK D Sbjct: 287 ETEDIVERIGVERSRKALADSDLILLVLNQSEELTEEDRQLLE--ATKGLKRVILLNKMD 344
>TRPV5_RABIT (Q9XSM3) Transient receptor potential cation channel subfamily V| member 5 (TrpV5) (osm-9-like TRP channel 3) (OTRPC3) (Epithelial calcium channel 1) (ECaC1) Length = 730 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDA---TILYIVV--PGKSVACQLETLLIN 317 H + C+ ++++V L H + QD+ T+L+I++ P K+ ACQ+ LL++ Sbjct: 165 HPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS 221
>TRPV6_RAT (Q9R186) Transient receptor potential cation channel subfamily V| member 6 (TrpV6) (Epithelial calcium channel 2) (ECaC2) (Calcium transport protein 1) (CaT1) Length = 727 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDA---TILYIVV--PGKSVACQLETLLIN 317 H + C+ ++++V L H + QD+ T+L+I++ P K+ ACQ+ LL++ Sbjct: 165 HPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS 221
>TRPV6_MOUSE (Q91WD2) Transient receptor potential cation channel subfamily V| member 6 (TrpV6) (Epithelial calcium channel 2) (ECaC2) (Calcium transport protein 1) (CaT1) Length = 727 Score = 29.6 bits (65), Expect = 8.4 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 5/57 (8%) Frame = -2 Query: 472 HEILTPPCLQTDDLVGRLGAHRSKEGMQDA---TILYIVV--PGKSVACQLETLLIN 317 H + C+ ++++V L H + QD+ T+L+I++ P K+ ACQ+ LL++ Sbjct: 165 HPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS 221
>TRME_LACLA (Q9CDH8) Probable tRNA modification GTPase trmE| Length = 455 Score = 29.6 bits (65), Expect = 8.4 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 4/107 (3%) Frame = -2 Query: 583 VGRSSIYIIIRRDNKLYVGQVFAQSSIHVFFCSFV*G---HEILTPPCLQTDDLVGRLGA 413 VG+SS+ + R+ K V + + + + + G + T +TDDLV +G Sbjct: 233 VGKSSLLNQLLREEKAIVTDIAGTTRDVITEFANIGGVPLELVDTAGIRETDDLVEAIGV 292 Query: 412 HRSKEGMQDATILYIVVPGKSVACQLETLLIN-QLPSKGFKLTNKAD 275 RSK+ + +A ++ +V+ + + L+ S L NK D Sbjct: 293 ERSKKALAEADLVLLVLDASNELTDKDLELLELSKNSNRIVLLNKTD 339 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,848,343 Number of Sequences: 219361 Number of extensions: 2296569 Number of successful extensions: 5392 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 5209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5391 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)