| Clone Name | rbaal7h11 |
|---|---|
| Clone Library Name | barley_pub |
>CSKI1_RAT (Q8VHK2) Caskin-1 (CASK-interacting protein 1)| Length = 1430 Score = 31.6 bits (70), Expect = 1.2 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +2 Query: 320 PGRCMPSPPQIAPLTETPLREASRPMLLKPPRSPSSVSXQCVH*SPILQGSP 475 P P P + PL PL + S +KPP SP + Q V +QGSP Sbjct: 1196 PPPAEPPPTDLMPLPPLPLPDGSARKPVKPPVSPKPILAQPV---SKIQGSP 1244
>CSKI1_HUMAN (Q8WXD9) Caskin-1 (CASK-interacting protein 1)| Length = 1431 Score = 30.4 bits (67), Expect = 2.6 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = +2 Query: 320 PGRCMPSPPQIAPLTETPLREASRPMLLKPPRSPSSVSXQCVH*SPILQGSP 475 P P P +A L P E KPP SP V Q V P LQGSP Sbjct: 1195 PPPAEPPPTDLAHLPPLPPPEGEARKPAKPPVSPKPVLTQPV---PKLQGSP 1243
>PTPRZ_RAT (Q62656) Receptor-type tyrosine-protein phosphatase zeta precursor| (EC 3.1.3.48) (R-PTP-zeta) (Phosphacan) (3F8 chondroitin sulfate proteoglycan) (3H1 keratan sulfate proteoglycan) Length = 2316 Score = 30.4 bits (67), Expect = 2.6 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +2 Query: 332 MPSPPQIAPLTETPLREASRPMLLKPPRSPSSVSXQCVH*S--PILQGSPA 478 +PS P+ LTETP+ E S + P S S+ S +H + P+L SP+ Sbjct: 1207 LPSGPRDPVLTETPMVEQSSSSVSLPLASESASSKSTLHFTSVPVLNMSPS 1257
>POLG_YEFV2 (P19901) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3411 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 Query: 438 CXETEDGLRGGFRSIGLEASRRGVSV 361 C EDG+ G F+S L AS+RGV V Sbjct: 1501 CEHLEDGIYGIFQSTFLGASQRGVGV 1526
>POLG_YEFV1 (P03314) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3411 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 Query: 438 CXETEDGLRGGFRSIGLEASRRGVSV 361 C EDG+ G F+S L AS+RGV V Sbjct: 1501 CEHLEDGIYGIFQSTFLGASQRGVGV 1526
>LAT_HUMAN (O43561) Linker for activation of T-cells family member 1 (36 kDa| phospho-tyrosine adapter protein) (pp36) (p36-38) Length = 262 Score = 28.9 bits (63), Expect = 7.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 314 RRPGRCMPSPPQIAPLTETPLREASRPMLLKPPRSP 421 +RP P PP P+T P S+P LL PRSP Sbjct: 52 KRPHTVAPWPPAYPPVTSYP--PLSQPDLLPIPRSP 85
>ATX2_HUMAN (Q99700) Ataxin-2 (Spinocerebellar ataxia type 2 protein)| (Trinucleotide repeat-containing gene 13 protein) Length = 1312 Score = 28.9 bits (63), Expect = 7.5 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +2 Query: 314 RRPGRCMPSPPQIAPLTETPLREASRPMLLKPPRSPSSVSXQCVH*SPILQGSPA 478 R P R P + P TP R SRP +P R PS P GSPA Sbjct: 561 RPPSRYQSGPNSLPPRAATPTRPPSRPP-SRPSRPPS---------HPSAHGSPA 605
>NR1D1_HUMAN (P20393) Orphan nuclear receptor NR1D1 (V-erbA-related protein| EAR-1) (Rev-erbA-alpha) Length = 614 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 320 PGRCMPSPPQIAPLTETPLREASRPMLLKPPRSPS 424 PG PSPP AP+ + + P L PPRSPS Sbjct: 247 PGPMGPSPPP-APVPSPLVGFSQFPQQLTPPRSPS 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,205,489 Number of Sequences: 219361 Number of extensions: 1112030 Number of successful extensions: 2960 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2955 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)