| Clone Name | rbaal23h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOC_MYCGE (P47582) DNA-directed RNA polymerase beta' chain (EC ... | 28 | 8.9 | 2 | RPOC_MYCPN (P75271) DNA-directed RNA polymerase beta' chain (EC ... | 28 | 8.9 |
|---|
>RPOC_MYCGE (P47582) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1292 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 146 LLSPVAYTWLSPSLSPPCYLIFLFGCSYLVLE 51 L+SPVA+ W+S L P + + SY +E Sbjct: 107 LVSPVAHIWMSKELPSPSKISLVLNISYKEVE 138
>RPOC_MYCPN (P75271) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1290 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 146 LLSPVAYTWLSPSLSPPCYLIFLFGCSYLVLE 51 L+SPVA+ W+S L P + + SY +E Sbjct: 105 LVSPVAHIWMSKELPSPSKISLVLNISYKEVE 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,056,170 Number of Sequences: 219361 Number of extensions: 453890 Number of successful extensions: 1169 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)