| Clone Name | rbaal22o15 |
|---|---|
| Clone Library Name | barley_pub |
>RBN_VIBF1 (Q5E8Q1) tRNA-processing ribonuclease BN (EC 3.1.-.-) (RNase BN)| Length = 310 Score = 30.4 bits (67), Expect = 1.4 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 12 YVVQIVQXYMHPRSRSTTGKGKYISLLPLVPYLMMVISVIQR 137 Y++ + Q +H R + G YI+LL LVP + +++SV+ + Sbjct: 15 YLLFLKQRVIHDRLTVSAGYMAYITLLSLVPLITVLLSVLSQ 56
>RBN_VIBVY (Q7MQ07) tRNA-processing ribonuclease BN (EC 3.1.-.-) (RNase BN)| Length = 313 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +3 Query: 6 LCYVVQIVQXYMHPRSRSTTGKGKYISLLPLVPYLMMVISVIQRMA 143 + +V ++ H R G YI+LL +VP L +++S++ + + Sbjct: 20 IAFVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFS 65
>RBN_VIBVU (Q8DDS2) tRNA-processing ribonuclease BN (EC 3.1.-.-) (RNase BN)| Length = 313 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +3 Query: 6 LCYVVQIVQXYMHPRSRSTTGKGKYISLLPLVPYLMMVISVIQRMA 143 + +V ++ H R G YI+LL +VP L +++S++ + + Sbjct: 20 IAFVRYLIARMNHDRINVNAGYLAYITLLSIVPMLTVLLSILSKFS 65
>MAK2_SCHPO (O14002) Peroxide stress-activated histidine kinase mak2 (EC| 2.7.13.3) (Mcs4-associated kinase 2) (His-Asp phosphorelay kinase phk1) Length = 2310 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -1 Query: 152 SLSSHTLYHRDHHHQIGNKRQQRNIFSFSSCTATARMHIXLYYLH 18 SLS T H DHHHQ K RM Y+ H Sbjct: 1670 SLSWKTFIHPDHHHQFQEKLLNLKTLELGDIELLLRMEDGNYHWH 1714
>CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cyclase (EC 4.6.1.1)| (ATP pyrophosphate-lyase) (Protein rutabaga) Length = 2248 Score = 28.1 bits (61), Expect = 6.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 152 SLSSHTLYHRDHHHQIGNKRQQR 84 S H YH HHHQ ++QQR Sbjct: 1946 SQQRHQRYHHHHHHQQRQQQQQR 1968 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,012,031 Number of Sequences: 219361 Number of extensions: 257260 Number of successful extensions: 822 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)