| Clone Name | rbaal23d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PO24_POPJA (Q03275) Retrovirus-related Pol polyprotein from type... | 28 | 6.7 | 2 | CATA2_MAIZE (P12365) Catalase isozyme 2 (EC 1.11.1.6) | 28 | 8.8 |
|---|
>PO24_POPJA (Q03275) Retrovirus-related Pol polyprotein from type-1| retrotransposable element R2 (Retrovirus-related Pol polyprotein from type I retrotransposable element R2) [Includes: Reverse transcriptase (EC 2.7.7.49); Endonuclease] (Fragment) Length = 482 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 131 LRISYASSLHPD--SKYGSALLICKFXLVWD*PNFIPSVHHMSCA 3 LR++ S PD G +++C +VW+ PN + +H A Sbjct: 353 LRLADGSLRKPDLVMAQGDTIVVCDVTIVWEGPNPLTMAYHQKVA 397
>CATA2_MAIZE (P12365) Catalase isozyme 2 (EC 1.11.1.6)| Length = 491 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 64 LQMSNAEPYLESGWRLDAYEILSIRRQWPDHTSPLQ 171 L + +P +E RLD + L + + WP+ T PLQ Sbjct: 267 LYIQTMDPEMED--RLDDLDPLDVTKTWPEDTFPLQ 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,683,628 Number of Sequences: 219361 Number of extensions: 384541 Number of successful extensions: 691 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)