| Clone Name | rbaal23c12 |
|---|---|
| Clone Library Name | barley_pub |
>WRN_CAEEL (Q19546) Probable Werner syndrome ATP-dependent helicase homolog 1| (EC 3.6.1.-) Length = 1056 Score = 31.2 bits (69), Expect = 1.6 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 9/84 (10%) Frame = +2 Query: 32 CIITRTYHTGYRLTNPSTIDITPPELITSMQ---------VYTRMESTRTHIREEKMRTN 184 C++ + TG TN + D+ PPELI+ MQ VYT +R+ +E Sbjct: 875 CVVQFSKETGIA-TNVNANDMIPPELISKMQKVLSDAVRRVYTEHLISRSTAKEVATARG 933 Query: 185 RSSRTRWSFIEACSSCSGEEGTPL 256 S T +S++ + + E+G PL Sbjct: 934 ISEGTVYSYL----AMAVEKGLPL 953
>STOX1_HUMAN (Q6ZVD7) Storkhead-box protein 1 (Winged helix domain-containing| protein) Length = 989 Score = 30.4 bits (67), Expect = 2.7 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 2/76 (2%) Frame = +2 Query: 44 RTYHTG--YRLTNPSTIDITPPELITSMQVYTRMESTRTHIREEKMRTNRSSRTRWSFIE 217 + YHTG Y + P T IT T + + + ++ R +S T +E Sbjct: 176 KIYHTGEGYFIVTPQTYFITN----------TTTQENKRMLPSDESRLMPASMTYLVSME 225 Query: 218 ACSSCSGEEGTPLGHC 265 +C+ + E P+ HC Sbjct: 226 SCAESAQENAAPISHC 241
>FANCJ_CHICK (Q3YK19) Fanconi anemia group J protein homolog (EC 3.6.1.-)| (ATP-dependent RNA helicase BRIP1) (Protein FACJ) Length = 1252 Score = 30.4 bits (67), Expect = 2.7 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 104 ELITSMQVYTRMESTRTHIREEKMRTNRSSRTRWSFIEACSSCSGEE 244 +L+ +++VY + ++ + EK N S +T +S CS SG+E Sbjct: 187 QLVDALEVYNQRKNGELIVHSEKSVKNTSPQTLFSSCTECSCSSGKE 233
>HISX_ACIAD (Q6FEC8) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 430 Score = 28.9 bits (63), Expect = 7.8 Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 80 STIDITPPELITSMQVYTRMESTRTHIREEKMRTNRSSRTR--WSFIEACSSCSGEEGTP 253 S +++T +L T+ + T + E++R+ ++ + WS+++A + G++ TP Sbjct: 65 SDLELTQEQLKTAFEALTAEIREALELAAERIRSFHQAQKQEGWSYVDALGNTLGQKVTP 124 Query: 254 L 256 L Sbjct: 125 L 125
>KGP24_DROME (Q03043) cGMP-dependent protein kinase, isozyme 2 forms| cD4/T1/T3A/T3B (EC 2.7.11.12) (CGK) (Foraging protein) Length = 1088 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 73 QPEHN*HYSTGTHNQYASIHKNGIHKNTHPRGKN---ENKSFLQNKMV 207 Q E N +Y T SI N + NTHP G N N S + N +V Sbjct: 171 QQEPNANYQFPTDLGLVSIVNNNNNTNTHPSGSNSGSNNNSNINNNLV 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,590,129 Number of Sequences: 219361 Number of extensions: 963842 Number of successful extensions: 2752 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2748 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)