| Clone Name | rbaal23c09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CEND3_MOUSE (Q8R5G7) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GA... | 28 | 9.0 | 2 | CEND3_HUMAN (Q8WWN8) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GA... | 28 | 9.0 |
|---|
>CEND3_MOUSE (Q8R5G7) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 3) (Dual specificity Rho- and Arf-GTPase-activating protein 1) Length = 1538 Score = 27.7 bits (60), Expect = 9.0 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -1 Query: 160 SSSRRXQHIXFSRYIVDWFLSHLSYKEELRCSTLSSCIHTQ-TLGHWAQPKP 8 S + Q I R V F + + +L CSTL SC+ Q LGH P P Sbjct: 338 SKDNKFQVITGQRVFV--FRTESEAQRDLWCSTLQSCLKEQRLLGHPRPPHP 387
>CEND3_HUMAN (Q8WWN8) Centaurin-delta 3 (Cnt-d3) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 3) Length = 1544 Score = 27.7 bits (60), Expect = 9.0 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = -1 Query: 160 SSSRRXQHIXFSRYIVDWFLSHLSYKEELRCSTLSSCIHTQ-TLGHWAQPKP 8 S + Q I R V F + + ++ CSTL SC+ Q LGH P+P Sbjct: 343 SKDNKFQVITGQRVFV--FRTESEAQRDMWCSTLQSCLKEQRLLGHPRPPQP 392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,301,261 Number of Sequences: 219361 Number of extensions: 311546 Number of successful extensions: 919 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)