| Clone Name | rbaal22l15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor | 29 | 3.8 |
|---|
>HRPX_PLALO (P04929) Histidine-rich glycoprotein precursor| Length = 351 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 42 TVHPLFLHYSHEMRRPSDHHSHTIRLSHKAH 134 TVHP LH H P +HH H H Sbjct: 51 TVHPEHLHEEHHHHHPEEHHEPHHEEHHHHH 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,118,879 Number of Sequences: 219361 Number of extensions: 549122 Number of successful extensions: 1166 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)