| Clone Name | rbaal23a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP149_RAT (Q924Y8) Probable G-protein coupled receptor 149 (Indu... | 30 | 4.6 | 2 | GP149_MOUSE (Q3UVY1) Probable G-protein coupled receptor 149 (G-... | 30 | 4.6 | 3 | JHD2C_HUMAN (Q15652) Probable JmjC domain-containing histone dem... | 30 | 7.9 |
|---|
>GP149_RAT (Q924Y8) Probable G-protein coupled receptor 149 (Induced early in| differentiating astrocytes gene protein) Length = 730 Score = 30.4 bits (67), Expect = 4.6 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 535 LLFGADPLLG-GIKLGAAWGCFTRCSAPAVM 624 LL + PL G G+ + WGC T CS+P V+ Sbjct: 161 LLLASLPLCGWGVFVRTPWGCLTDCSSPYVL 191
>GP149_MOUSE (Q3UVY1) Probable G-protein coupled receptor 149 (G-protein coupled| receptor PGR10) Length = 732 Score = 30.4 bits (67), Expect = 4.6 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 535 LLFGADPLLG-GIKLGAAWGCFTRCSAPAVM 624 LL + PL G G+ + WGC T CS+P V+ Sbjct: 163 LLLASLPLCGWGVFVRTPWGCLTDCSSPYVL 193
>JHD2C_HUMAN (Q15652) Probable JmjC domain-containing histone demethylation| protein 2C (EC 1.14.11.-) (Jumonji domain-containing protein 1C) (Thyroid receptor-interacting protein 8) (TRIP-8) Length = 2540 Score = 29.6 bits (65), Expect = 7.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 629 HGMTAGALHRVKHPHAAPSLIP 564 H +T+G H V HPH P+++P Sbjct: 780 HPLTSGPHHAVHHPHLLPTVLP 801 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,254,762 Number of Sequences: 219361 Number of extensions: 2067585 Number of successful extensions: 5503 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5498 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)