| Clone Name | rbaal22h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HME1_MOUSE (P09065) Homeobox protein engrailed-1 (Mo-En-1) | 31 | 2.9 | 2 | GUC1B_RANPI (O73762) Guanylyl cyclase-activating protein 2 (GCAP... | 30 | 6.6 | 3 | CGP1_SCHPO (P87049) G1/S-specific cyclin pas1 | 30 | 6.6 | 4 | MS84B_DROME (Q01643) Male-specific sperm protein Mst84Db | 30 | 6.6 |
|---|
>HME1_MOUSE (P09065) Homeobox protein engrailed-1 (Mo-En-1)| Length = 401 Score = 31.2 bits (69), Expect = 2.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 234 VAHYIHMLPHAPN*PKPSISPALHLHAAGARPEVA 338 +AH+ H+ PH P P P P HL A +P+ A Sbjct: 66 LAHHPHLPPHPPPPPPPPPPPPQHLAAPAHQPQPA 100
>GUC1B_RANPI (O73762) Guanylyl cyclase-activating protein 2 (GCAP 2) (Guanylate| cyclase activator 1B) Length = 196 Score = 30.0 bits (66), Expect = 6.6 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -2 Query: 145 SRVGIDVSPLVIWYHHF*VVCGCG-VYVHL*KRFF 44 ++V IDV+ L WY F V C G +++H KRFF Sbjct: 9 NKVEIDVAELQEWYKKFVVECPSGTLFMHEFKRFF 43
>CGP1_SCHPO (P87049) G1/S-specific cyclin pas1| Length = 411 Score = 30.0 bits (66), Expect = 6.6 Identities = 24/84 (28%), Positives = 35/84 (41%) Frame = +1 Query: 70 RHHIHKRLRNDDTKLPMEIHQYQHDSSTLLLQAPCSAVQRSAAQPVITSQDP*DMSRITY 249 R + + L+N T+ P Q DSS +L AP + V + P S P ++ Sbjct: 203 RMNANAALKNQATRKPSSSPQTTQDSSPILTMAPSTPVSVGSTPPSTPSVLP-IAKQLAP 261 Query: 250 ICYHTLQINPSLPSRLHCTCTPPE 321 + I S SR T +PPE Sbjct: 262 MNVCKAHIQASNQSRTLTTASPPE 285
>MS84B_DROME (Q01643) Male-specific sperm protein Mst84Db| Length = 74 Score = 30.0 bits (66), Expect = 6.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 613 CRPCGASXRSCG*CRPWC 666 C PCG CG CRP+C Sbjct: 55 CGPCGPCGPCCGPCRPYC 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,732,615 Number of Sequences: 219361 Number of extensions: 1051839 Number of successful extensions: 3127 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3124 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)