| Clone Name | rbaal21o05 |
|---|---|
| Clone Library Name | barley_pub |
>COX1_BRAJA (P31833) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) (Cytochrome aa3 subunit 1) Length = 541 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 253 YWFEKLTWIHYHTLSHTLFFWVVAVGVGTV 164 YWF K+T Y+ FWV +GV V Sbjct: 422 YWFPKMTGYMYNETLAKAHFWVTFIGVNLV 451
>COX1_METSE (Q35101) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 530 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 253 YWFEKLTWIHYHTLSHTLFFWVVAVGV 173 +WF K+T Y+ L + FW++ +GV Sbjct: 398 FWFGKITGYCYNELYGKIHFWIMFIGV 424
>RUVA_SYMTH (Q67Q98) Holliday junction ATP-dependent DNA helicase ruvA (EC| 3.6.1.-) Length = 205 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +2 Query: 26 ASTSSQTPRRSALLRLYTYQHIRE 97 AST S+ P + A ++LYTY +RE Sbjct: 32 ASTRSRLPAQGAAVQLYTYLQVRE 55
>COX1_SCHPO (P07657) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 537 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 259 ALYWFEKLTWIHYHTLSHTLFFWVVAVGVGTVQDRTHXM 143 A YW K+ + Y+ ++ FW++ +GV V H + Sbjct: 399 AYYWSPKMFGLMYNETLASIQFWILFIGVNIVFGPQHFL 437
>Y105_MYCBO (P64690) Hypothetical protein Mb0105| Length = 661 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 289 YSSPFFDPAIALYWFEKLTWIHYHTLSHTLFFWVV 185 Y +P FD + +W + IH+ + + LF+W + Sbjct: 503 YFTPLFDTFVRYHWGHEFMAIHFLVVGY-LFYWAI 536
>Y102_MYCTU (P64689) Hypothetical protein Rv0102/MT0111| Length = 661 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 289 YSSPFFDPAIALYWFEKLTWIHYHTLSHTLFFWVV 185 Y +P FD + +W + IH+ + + LF+W + Sbjct: 503 YFTPLFDTFVRYHWGHEFMAIHFLVVGY-LFYWAI 536
>PDLI4_MOUSE (P70271) PDZ and LIM domain protein 4 (LIM protein RIL)| (Reversion-induced LIM protein) Length = 330 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 97 NNQSXNGLSLPTQLSSXCVFYPVLXQLLRQLPKKTEC 207 +N S N +LP Q+S+ V P R LP+ +C Sbjct: 146 HNGSSNEATLPAQMSALHVSPPTSADTARVLPRNRDC 182 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,298,008 Number of Sequences: 219361 Number of extensions: 675517 Number of successful extensions: 1368 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1368 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)