| Clone Name | rbaal22c12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN593_MOUSE (Q9DB42) Zinc finger protein 593 (Zinc finger protei... | 39 | 0.004 | 2 | ZN593_HUMAN (O00488) Zinc finger protein 593 (Zinc finger protei... | 39 | 0.004 | 3 | BUD20_YEAST (Q08004) Bud site selection protein 20 | 31 | 0.74 | 4 | ZN533_MOUSE (Q8BXJ8) Zinc finger protein 533 | 30 | 2.1 |
|---|
>ZN593_MOUSE (Q9DB42) Zinc finger protein 593 (Zinc finger protein T86)| Length = 116 Score = 38.9 bits (89), Expect = 0.004 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = -3 Query: 253 HYRSKRHKKRVKQLSGPAPHTQIDADLAGGMG 158 H+RSK HKKR+KQLS P++Q +A+ A GMG Sbjct: 61 HFRSKDHKKRLKQLS-VEPYSQEEAERAAGMG 91
>ZN593_HUMAN (O00488) Zinc finger protein 593 (Zinc finger protein T86)| Length = 116 Score = 38.9 bits (89), Expect = 0.004 Identities = 19/32 (59%), Positives = 25/32 (78%) Frame = -3 Query: 253 HYRSKRHKKRVKQLSGPAPHTQIDADLAGGMG 158 H+RSK HKKR+KQLS P++Q +A+ A GMG Sbjct: 61 HFRSKDHKKRLKQLS-VEPYSQEEAERAAGMG 91
>BUD20_YEAST (Q08004) Bud site selection protein 20| Length = 166 Score = 31.2 bits (69), Expect = 0.74 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 253 HYRSKRHKKRVKQLSGPAPHTQIDADLAGGMGM 155 H + K HK+RVK+L G P+TQ +D A G + Sbjct: 67 HLKGKVHKRRVKELRG-VPYTQEVSDAAAGYNL 98
>ZN533_MOUSE (Q8BXJ8) Zinc finger protein 533| Length = 482 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -3 Query: 253 HYRSKRHKKRVKQLSG--PAPHTQIDADLAGG 164 HY K H+KRVKQLS P P Q L G Sbjct: 52 HYDGKSHRKRVKQLSDGQPPPPVQGSVPLLAG 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,590,352 Number of Sequences: 219361 Number of extensions: 606928 Number of successful extensions: 1553 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1553 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)