ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal21j24 |
|---|---|
| Clone Library Name | barley_pub |
>PCP_DEIRA (Q9RX25) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 218 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 3/38 (7%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG---IKSLFVHVPLFSTV 280 AG +VCN+V YH+L + +HG + F+HVP + V Sbjct: 139 AGLYVCNFVLYHALHWLREHGRGAVPCGFLHVPANAAV 176
>PCP_THELI (O07883) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) Length = 220 Score = 33.9 bits (76), Expect = 0.098 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG--IKSLFVHVPLFSTVDEEVQIHF 256 AG ++CNYV + +L F++ G +K+ F+HVP T D+ V F Sbjct: 138 AGTYLCNYVMFKTLHFSKIEGYPLKAGFIHVPY--TPDQVVNKFF 180
>PGPI_HUMAN (Q9NXJ5) Pyroglutamyl-peptidase 1 (EC 3.4.19.3)| (Pyroglutamyl-peptidase I) (Pyrrolidone-carboxylate peptidase) (5-oxoprolyl-peptidase) (PGP-I) Length = 209 Score = 33.5 bits (75), Expect = 0.13 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVP 295 AGR++C++ YY SL + HG +S FVHVP Sbjct: 144 AGRYLCDFTYYTSL--YQSHG-RSAFVHVP 170
>PCP_VIBVY (Q7MG84) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 33.5 bits (75), Expect = 0.13 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVPL 292 AG FVCN+++Y I+S F+H+PL Sbjct: 138 AGTFVCNHLFYGVQHHLHTRAIRSGFIHIPL 168
>PCP_VIBVU (Q8D4N5) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 33.5 bits (75), Expect = 0.13 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVPL 292 AG FVCN+++Y I+S F+H+PL Sbjct: 138 AGTFVCNHLFYGVQHHLHTRAIRSGFIHIPL 168
>PCP_VIBPA (Q87IL9) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 33.5 bits (75), Expect = 0.13 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVPL 292 AG FVCN+++Y + I+ FVH+PL Sbjct: 138 AGTFVCNHLFYGVQHYLRDKSIRHGFVHIPL 168
>PCP_BACCR (Q81BT3) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 32.7 bits (73), Expect = 0.22 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG--IKSLFVHVP 295 AG FVCN+++Y + E+H IK F+H+P Sbjct: 138 AGTFVCNHLFYGLMHELEKHDKKIKGGFIHIP 169
>PCP_PSEFL (P42673) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 213 Score = 32.3 bits (72), Expect = 0.28 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVP 295 AG FVCN V+Y G++S F+HVP Sbjct: 139 AGTFVCNQVFYLLQHALAGSGVRSGFIHVP 168
>PCP1_RALSO (Q8XXE9) Pyrrolidone-carboxylate peptidase 1 (EC 3.4.19.3)| (5-oxoprolyl-peptidase 1) (Pyroglutamyl-peptidase I 1) (PGP-I 1) (Pyrase 1) Length = 215 Score = 32.3 bits (72), Expect = 0.28 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGI--KSLFVHVP 295 AG FVCN+V+Y + HG+ + F+H+P Sbjct: 138 AGTFVCNHVFYGLMHAIAHHGLHARGGFIHIP 169
>PCP_BACHK (Q6HH08) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG--IKSLFVHVP 295 AG FVCN+++Y + E+H +K F+H+P Sbjct: 138 AGTFVCNHLFYGLMHELEKHDTKMKGGFIHIP 169
>PCP_BACAN (Q81NT5) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG--IKSLFVHVP 295 AG FVCN+++Y + E+H +K F+H+P Sbjct: 138 AGTFVCNHLFYGLMHELEKHDTKMKGGFIHIP 169
>PCP_ERWCT (Q6D7H1) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 31.2 bits (69), Expect = 0.63 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG--IKSLFVHVP 295 AG FVCN+V Y L Q G ++ FVH+P Sbjct: 138 AGTFVCNHVMYGLLHQLHQQGDVVRGGFVHIP 169
>PCP_FUSNN (Q8RI83) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 214 Score = 30.8 bits (68), Expect = 0.83 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQ--HGIKSLFVHVP 295 AG FVCN+V+Y E+ G KS F+H+P Sbjct: 137 AGTFVCNHVFYGVRYLIEKKYKGKKSGFIHIP 168
>PGPI_MOUSE (Q9ESW8) Pyroglutamyl-peptidase 1 (EC 3.4.19.3)| (Pyroglutamyl-peptidase I) (Pyrrolidone-carboxylate peptidase) (5-oxoprolyl-peptidase) (PGP-I) Length = 209 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVP 295 AGR++C++ YY SL Q +S FVHVP Sbjct: 144 AGRYLCDFTYYTSL---YQGRGRSAFVHVP 170
>PCP_PYRFU (O73944) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 208 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSL--FVHVP 295 AG ++CNYV Y SL + G + F+HVP Sbjct: 137 AGLYLCNYVMYLSLHHSATKGYPKMSGFIHVP 168
>PCP_STAAU (Q53596) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG FVCN+V YH ++H ++ F+HVP Sbjct: 136 AGTFVCNHVLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP_STAAR (Q6GDB4) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG FVCN+V YH ++H ++ F+HVP Sbjct: 136 AGTFVCNHVLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP1_SULSO (P58201) Pyrrolidone-carboxylate peptidase 1 (EC 3.4.19.3)| (5-oxoprolyl-peptidase 1) (Pyroglutamyl-peptidase I 1) (PGP-I 1) (Pyrase 1) Length = 211 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVPLFSTVDEEVQ 265 AG ++CN Y +R A ++ F+HVPL + +Q Sbjct: 137 AGSYLCNNAMYIIIREARKYNSLGGFIHVPLHESYAARIQ 176
>PCP2_SULSO (P58202) Pyrrolidone-carboxylate peptidase 2 (EC 3.4.19.3)| (5-oxoprolyl-peptidase 2) (Pyroglutamyl-peptidase I 2) (PGP-I 2) (Pyrase 2) Length = 209 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSLFVHVPLFSTVDEEVQ 265 AG ++CN Y +R A ++ F+HVPL + +Q Sbjct: 137 AGSYLCNNAMYIIIREARKYNSLGGFIHVPLHESYAARIQ 176
>PCP_ENTFA (Q838N8) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 213 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRF--AEQHGIKSLFVHVPLF--STVDE 274 AG FVCN + YH L + I+ F+HVP T+D+ Sbjct: 136 AGTFVCNDIMYHLLHLINTKYPTIRGGFIHVPFLPEQTIDK 176
>PCP_OCEIH (Q8ENE4) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 199 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG ++CN+V Y +L EQ I S F+H+P Sbjct: 137 AGAYLCNHVMYRALHEIEQQKLDIFSGFIHIP 168
>PCP_BACHD (Q9K6U4) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 201 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGIKSL---FVHVP 295 AG +VCN+V Y L + + G + + FVH+P Sbjct: 138 AGTYVCNHVMYRMLDYLHEKGSEQVAAGFVHLP 170
>PCP_STAAN (P65677) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG +VCN+V YH ++H ++ F+HVP Sbjct: 136 AGTYVCNHVLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP_STAAM (P65676) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG +VCN+V YH ++H ++ F+HVP Sbjct: 136 AGTYVCNHVLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP_TREDE (Q73RB6) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 217 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 384 AGRFVCNYVYY-----HSLRFAEQHGIKSLFVHVP 295 AG F+CN+V Y + R A+ +KS F+H+P Sbjct: 136 AGTFICNHVCYGVAHIAAARTAQGKPMKSGFIHIP 170
>PCP_STAAW (Q8NUH2) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG FVCN+ YH ++H ++ F+HVP Sbjct: 136 AGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP_STAAS (Q6G5Y4) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG FVCN+ YH ++H ++ F+HVP Sbjct: 136 AGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP_STAAC (Q5HCK7) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 212 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQH--GIKSLFVHVP 295 AG FVCN+ YH ++H ++ F+HVP Sbjct: 136 AGTFVCNHTLYHLGYLQDKHYPHLRFGFIHVP 167
>PCP_CLOPE (Q8XKH1) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 213 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQ--HGIKSLFVHVP 295 AG FVCN+V Y L + I++ F+HVP Sbjct: 136 AGTFVCNHVMYGVLYLVNKKYKNIRAGFIHVP 167
>PCP_PYRAB (Q9UYQ9) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 200 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHGI--KSLFVHVP 295 AG ++CN+V Y +L + G K+ F+HVP Sbjct: 137 AGTYLCNFVMYLTLHHSATKGYPRKAGFIHVP 168
>PCP_BACSU (P28618) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQHG--IKSLFVHVPLF--STVDE 274 AG FVCNY++Y + + I+ F+H+P T+D+ Sbjct: 139 AGTFVCNYLFYGLMDHISRTSPHIRGGFIHIPYIPQQTIDK 179
>PCP_YERPS (Q667T6) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQ--HGIKSLFVHVP 295 AG +VCN+V Y L Q + +K F+H+P Sbjct: 138 AGTYVCNHVMYGLLHRLNQFNNEVKGGFIHIP 169
>PCP_YERPE (Q8ZD86) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)| (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I) (Pyrase) Length = 215 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 384 AGRFVCNYVYYHSLRFAEQ--HGIKSLFVHVP 295 AG +VCN+V Y L Q + +K F+H+P Sbjct: 138 AGTYVCNHVMYGLLHRLNQFNNEVKGGFIHIP 169
>CRNF_LYMST (P91758) Cysteine-rich neurotrophic factor precursor (CRNF)| Length = 121 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 7/51 (13%) Frame = -1 Query: 144 CGDWRLLVRSCSKE-GCI*GERKRKKNDALECV--C----VKCRLACHQLH 13 C DW L +C KE C + N+ + C+ C + CR C++++ Sbjct: 31 CNDWNQLEMACQKEKDCFEKTNNQFTNETVACMQPCWDLGIPCRTQCYKVY 81
>ATG26_CRYNE (Q5KK25) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1585 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 179 RCKVGRRLNKN-CVVIGAYWSDLAPKKGVFKGREKG 75 RC V +N C ++ WSD KKG KG +G Sbjct: 1307 RCVVEAVVNSGVCAILSKGWSDRGSKKGEPKGDSEG 1342 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,003,390 Number of Sequences: 219361 Number of extensions: 874286 Number of successful extensions: 2396 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 2349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2394 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
