| Clone Name | rbaal21j19 |
|---|---|
| Clone Library Name | barley_pub |
>Y126_ADE07 (P05670) Hypothetical 12.6 kDa early protein| Length = 114 Score = 30.8 bits (68), Expect = 3.4 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = -2 Query: 554 RAARGPGGAEDHPSSRRGSC---QFYGHRVVARG-RHTARSRESGQDLRAPGDQHPAAPP 387 R R A H S R + + GH A+G R+ A R Q R GDQ P+ PP Sbjct: 41 RPVRALDTASKHARSNRATAAQKEKQGHGGSAQGARNPASHRHLHQ--RTRGDQVPSEPP 98 Query: 386 GRPRQ 372 RPR+ Sbjct: 99 SRPRK 103
>TPSX_SCHPO (O14081) Putative alpha,alpha-trehalose-phosphate synthase| [UDP-forming] subunit 106 kDa subunit (EC 2.4.1.15) (Trehalose-6-phosphate synthase) (UDP-glucose-glucosephosphate glucosyltransferase) Length = 944 Score = 30.0 bits (66), Expect = 5.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 470 ARGRHTARSRESGQDLRAPGDQHPAAPP 387 +RGRH A S+ G +L P +H + PP Sbjct: 121 SRGRHMAFSKNDGTNLSLPPSRHQSPPP 148
>TPR_HUMAN (P12270) Nucleoprotein TPR| Length = 2349 Score = 30.0 bits (66), Expect = 5.7 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +3 Query: 12 HKSQSPPMITTTT---ATPQHTEGGDERNRHFCRSMSTVVVSDRSL 140 H SQS PM+TT+T +T T GD+ + F + S + S+ L Sbjct: 2222 HASQSVPMVTTSTGTLSTTNETATGDDGDEVFVEAESEGISSEAGL 2267
>PS1C2_PANTR (Q7YR45) Psoriasis susceptibility 1 candidate gene 2 protein| homolog precursor (SPR1 protein) Length = 136 Score = 29.6 bits (65), Expect = 7.5 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = -2 Query: 545 RGPGGAEDHPSSRRGSCQFYGHRVVARGRHTARSRESGQDLRAPGDQHPAAPP 387 RG G+EDHPS A R A S Q PGD P APP Sbjct: 18 RGISGSEDHPS-----------HPPAEDREEAGSPTLPQGPPVPGDPWPGAPP 59
>RSEA_ECOLI (P0AFX7) Sigma-E factor negative regulatory protein| Length = 216 Score = 29.3 bits (64), Expect = 9.8 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +2 Query: 17 IAIASNDNNNNGDPAAYRGGRRKEPSFLQVYVHRRRVGPEPLRLPLAQVQREA 175 + + S NNG + RR+ + LQ Y +RR+ E L+ AQ Q+ A Sbjct: 150 LGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAA 202
>RSEA_ECOL6 (P0AFX8) Sigma-E factor negative regulatory protein| Length = 216 Score = 29.3 bits (64), Expect = 9.8 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +2 Query: 17 IAIASNDNNNNGDPAAYRGGRRKEPSFLQVYVHRRRVGPEPLRLPLAQVQREA 175 + + S NNG + RR+ + LQ Y +RR+ E L+ AQ Q+ A Sbjct: 150 LGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAA 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,645,009 Number of Sequences: 219361 Number of extensions: 1400217 Number of successful extensions: 4793 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4784 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)