| Clone Name | rbaal21i16 |
|---|---|
| Clone Library Name | barley_pub |
>PA2G6_RAT (P97570) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 751 Score = 37.0 bits (84), Expect = 0.044 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 360 LEVTDLLRGVPGQEDIHLGLELDQRSCLHGEEQVACVRAVPSEHLPTVVH 509 L++TDL+R P HL +EL R C H + C + +E T +H Sbjct: 107 LQLTDLIRNHPSWTVTHLAVELGIRECFHHSRIITCANSTENEEGCTPLH 156
>PA2G6_MOUSE (P97819) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 752 Score = 35.8 bits (81), Expect = 0.098 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +3 Query: 336 SVEVAALDL--EVTDLLRGVPGQEDIHLGLELDQRSCLHGEEQVACVRAVPSEHLPTVVH 509 SV+V +++ +TDL+R P HL +EL R C H ++C + +E T +H Sbjct: 98 SVQVLHVEVLQHLTDLIRNHPSWTVTHLAVELGIRECFHHSRIISCANSTENEEGCTPLH 157
>PA2G6_HUMAN (O60733) 85 kDa calcium-independent phospholipase A2 (EC 3.1.1.4)| (iPLA2) (CaI-PLA2) (Group VI phospholipase A2) (GVI PLA2) Length = 806 Score = 35.0 bits (79), Expect = 0.17 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 366 VTDLLRGVPGQEDIHLGLELDQRSCLHGEEQVACVRAVPSEHLPTVVH 509 +TDL+R P HL +EL R C H ++C +E T +H Sbjct: 110 LTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLH 157
>POLG_DEN1T (P29983) Genome polyprotein [Contains: Envelope protein M (Matrix| protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 555 Score = 31.6 bits (70), Expect = 1.8 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = -1 Query: 596 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 450 GA+ S RT LD M LLTM+EK++ +H +W + G ST N DLL Sbjct: 228 GALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 287 Query: 449 TVKT 438 T KT Sbjct: 288 TFKT 291
>POLG_DEN1S (P33478) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3396 Score = 31.6 bits (70), Expect = 1.8 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = -1 Query: 596 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 450 GA+ S RT LD M LLTM+EK++ +H +W + G ST N DLL Sbjct: 459 GALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 518 Query: 449 TVKT 438 T KT Sbjct: 519 TFKT 522
>POLG_DEN1W (P17763) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A)] (Fragment) Length = 1226 Score = 30.4 bits (67), Expect = 4.1 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = -1 Query: 596 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 450 GA+ S RT LD M LLTM++K++ +H +W + G ST N DLL Sbjct: 459 GALTLDCSPRTGLDFNEMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 518 Query: 449 TVKT 438 T KT Sbjct: 519 TFKT 522
>POLG_DEN18 (P27910) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1)] (Fragment) Length = 792 Score = 30.4 bits (67), Expect = 4.1 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 11/64 (17%) Frame = -1 Query: 596 GAIFSIRSRRTILDGAGMPLLTMQEKAFSMHHRWQV------FRGDST-----NAGDLLF 450 GA+ S RT LD M LLTM++K++ +H +W + G ST N DLL Sbjct: 459 GALTLDCSPRTGLDFNRMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLV 518 Query: 449 TVKT 438 T KT Sbjct: 519 TFKT 522
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 276 DGFECAAREGHVQCHRVPARRLRVHREPCCD 184 DG C GH +C+ P RL+ R P C+ Sbjct: 668 DGGFCINFPGHYKCNCYPGYRLKASRPPICE 698
>LTBP3_HUMAN (Q9NS15) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1302 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 276 DGFECAAREGHVQCHRVPARRLRVHREPCCD 184 DG C GH +C+ P RL+ R P C+ Sbjct: 671 DGGFCINFPGHYKCNCYPGYRLKASRPPVCE 701
>EPOR_CANFA (Q2KL21) Erythropoietin receptor precursor (EPO-R)| Length = 508 Score = 29.3 bits (64), Expect = 9.2 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 5/73 (6%) Frame = +3 Query: 324 EDAGSVEVAALDL--EVTDLLRGV---PGQEDIHLGLELDQRSCLHGEEQVACVRAVPSE 488 + GS+++ A+D E + G+ PG E LG + + L Q+ C RA+P E Sbjct: 387 QSGGSLDIVAMDKGSEASSCSSGLSLKPGPEGA-LGASFEY-TILDPSSQLLCPRALPPE 444 Query: 489 HLPTVVHTERLFL 527 PT H + L+L Sbjct: 445 LPPTPPHIKYLYL 457 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,866,354 Number of Sequences: 219361 Number of extensions: 1295429 Number of successful extensions: 3595 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3595 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)