| Clone Name | rbaal20p07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GID7_YEAST (P25569) Glucose-induced degradation protein 7 | 33 | 0.47 | 2 | RUSC2_MOUSE (Q80U22) RUN and SH3 domain-containing protein 2 | 32 | 1.8 | 3 | S26A3_RAT (Q924C9) Chloride anion exchanger (DRA protein) (Down-... | 30 | 4.0 | 4 | RIG_DROME (Q86BY9) Protein rigor mortis | 29 | 8.9 | 5 | VE2_HPV25 (P36787) Regulatory protein E2 | 29 | 8.9 |
|---|
>GID7_YEAST (P25569) Glucose-induced degradation protein 7| Length = 759 Score = 33.5 bits (75), Expect = 0.47 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Frame = -1 Query: 589 ISHASYSCNSQLVFAAFTDGNVAIFDADNLRLRCRIASS-AYMSTAAINSNPPIYPF--V 419 I + ++ ++LV + DG + I+D R+R + S + ST NS P+ V Sbjct: 676 IIRSCFAYGNKLVMSGSEDGKIYIWD----RIRGNLVSVLSGHSTVMSNSTKPMGKNCNV 731 Query: 418 VAAHPQEPNQFAVGLSDGSVKV 353 VA++P + FA G DG +K+ Sbjct: 732 VASNPADKEMFASGGDDGKIKI 753
>RUSC2_MOUSE (Q80U22) RUN and SH3 domain-containing protein 2| Length = 1514 Score = 31.6 bits (70), Expect = 1.8 Identities = 22/66 (33%), Positives = 27/66 (40%) Frame = -1 Query: 436 PIYPFVVAAHPQEPNQFAVGLSDGSVKVMEPLESDGKWGTPAPVENGVANGRVPASSATS 257 PI PFV H P Q A + S+ + L + PAP+ A G PA S Sbjct: 688 PIQPFVFQHH--FPKQLAKARALHSLSQLYSLSGCSRAQQPAPLVISTAQGPAPAPSGEP 745 Query: 256 NPATDQ 239 P T Q Sbjct: 746 QPFTSQ 751
>S26A3_RAT (Q924C9) Chloride anion exchanger (DRA protein) (Down-regulated in| adenoma) (Solute carrier family 26 member 3) Length = 757 Score = 30.4 bits (67), Expect = 4.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 461 YGSHKQQSTHLPFCCRCTSPRTKSI 387 YG HK HL CC C+S + K I Sbjct: 29 YGHHKTFLDHLKGCCSCSSQKAKKI 53
>RIG_DROME (Q86BY9) Protein rigor mortis| Length = 1235 Score = 29.3 bits (64), Expect = 8.9 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 1/92 (1%) Frame = -1 Query: 589 ISHASY-SCNSQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVA 413 IS SY S +F DG + I + D+ + + S ++ +A+ + Y +A Sbjct: 695 ISRPSYLSIRDSFLFVGTDDGLLQIHERDSGMEK---SWSPFIRQSALFAR---YVTDIA 748 Query: 412 AHPQEPNQFAVGLSDGSVKVMEPLESDGKWGT 317 P + N+FAV +D SV VME ++ W T Sbjct: 749 WCPLDSNKFAVSGNDRSVYVMEFQPTERNWKT 780
>VE2_HPV25 (P36787) Regulatory protein E2| Length = 502 Score = 29.3 bits (64), Expect = 8.9 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 6/80 (7%) Frame = -2 Query: 447 TAIHPFTLLLSLHIPKNQINSQSGCQMDLLK*WSRWSPTGSGERLLQWKMGW------PT 286 T P T P Q +S + + SR SPTGSGER Q P+ Sbjct: 193 TVFTPVTSSTPPESPGGQADSNTSSKTPTTDTASRLSPTGSGERSQQTSTKGRRYERRPS 252 Query: 285 AGCQHHQLQAIQPQIKTKDR 226 + + Q QA Q + ++K R Sbjct: 253 SRTRRQQAQARQRRSRSKSR 272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,177,183 Number of Sequences: 219361 Number of extensions: 1856493 Number of successful extensions: 4892 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4891 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)