| Clone Name | rbaal21e13 |
|---|---|
| Clone Library Name | barley_pub |
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 95.1 bits (235), Expect = 5e-20 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -1 Query: 170 GSFYGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 45 GSFYGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF Sbjct: 423 GSFYGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 464
>RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 474 Score = 75.5 bits (184), Expect = 4e-14 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 170 GSFYGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 45 G+FYGKGAQQ LPVPEGCTD A+N+DPTARSDDG+C+Y F Sbjct: 433 GTFYGKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
>RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 472 Score = 70.1 bits (170), Expect = 2e-12 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 170 GSFYGKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLY 51 G+F+GK AQQ +LPV +GCTD AKNYDPTARSDDGSC Y Sbjct: 431 GTFFGKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470
>RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase activase 1,| chloroplast precursor (RuBisCO activase 1) (RA 1) (RubisCO activase alpha form) Length = 476 Score = 67.4 bits (163), Expect = 1e-11 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 170 GSFYGKGAQQ--GTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 45 G+FYG A Q G +PVPEGCTD A NYDPTARSDDGSC+Y F Sbjct: 433 GTFYGGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
>CCMF_ARATH (P93286) Putative cytochrome c biogenesis ccmF-like mitochondrial| protein Length = 442 Score = 29.3 bits (64), Expect = 3.0 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -3 Query: 168 FLLR*RSTARYFARAGRLHRPKCQELRPNGKERRR 64 FL R RS R AR R K Q LRPNG E+RR Sbjct: 140 FLARDRSAKRERAR-----RRKGQTLRPNGNEQRR 169
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 28.5 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 62 CRRRSLPLGRSSWHFGRCNLP 124 CRR P GR H GRCN P Sbjct: 2114 CRRCQCPGGRCDPHTGRCNCP 2134
>YKB4_YEAST (P34241) Hypothetical 203.3 kDa protein in PUT3-ARC19 intergenic| region Length = 1764 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 128 VPEGCTDQNAKNYDPTARSD 69 VPE TD N NYD T R D Sbjct: 1383 VPELYTDSNTNNYDATTRCD 1402 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,408,939 Number of Sequences: 219361 Number of extensions: 393016 Number of successful extensions: 1060 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)