| Clone Name | rbaal6p24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YG3K_YEAST (P48235) Hypothetical 24.0 kDa protein in MOL1-NAT2 i... | 31 | 2.6 |
|---|
>YG3K_YEAST (P48235) Hypothetical 24.0 kDa protein in MOL1-NAT2 intergenic| region Length = 211 Score = 31.2 bits (69), Expect = 2.6 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 297 THLHQNVKAGHGHPLLVPPLDMSQKLLAPGLF 202 +HLH+ K H H L PPL S+ L A LF Sbjct: 65 SHLHKKSKTSHSHN-LTPPLSYSKNLTASNLF 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,169,446 Number of Sequences: 219361 Number of extensions: 2052360 Number of successful extensions: 4534 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4533 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)