| Clone Name | rbaal20o21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HEPH_RAT (Q920H8) Hephaestin precursor (EC 1.-.-.-) | 29 | 9.6 |
|---|
>HEPH_RAT (Q920H8) Hephaestin precursor (EC 1.-.-.-)| Length = 1157 Score = 29.3 bits (64), Expect = 9.6 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -3 Query: 175 YCTPWLLPTKNFTNLSTCFVSIYLQISYQSIFKMDGC 65 + T ++P K+ T L +C V+ +L+ Q+ +K+D C Sbjct: 330 FVTAEMVPQKSGTWLISCVVNSHLKSGMQAFYKVDSC 366 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,713,190 Number of Sequences: 219361 Number of extensions: 1987837 Number of successful extensions: 5377 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5372 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)